KEGG   Bacillus subtilis subsp. subtilis 168: BSU35960
Entry
BSU35960          CDS       T00010                                 

Gene name
rbsB
Definition
(RefSeq) D-ribose-binding protein
  KO
K10439  ribose transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU35960 (rbsB)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU35960 (rbsB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU35960 (rbsB)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    BSU35960 (rbsB)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 PucR DUF2070 OrfB_Zn_ribbon Glyco_trans_1_4 ANF_receptor PCP_red
Other DBs
NCBI-GeneID: 936848
NCBI-ProteinID: NP_391477
Pasteur: BG10881
BSORF: BG10881
UniProt: P36949 A0A6M3ZHA8
Position
3706145..3707062
AA seq 305 aa
MKKAVSVILTLSLFLLTACSLEPPQWAKPSNSGNKKEFTIGLSVSTLNNPFFVSLKKGIE
KEAKKRGMKVIIVDAQNDSSKQTSDVEDLIQQGVDALLINPTDSSAISTAVESANAVGVP
VVTIDRSAEQGKVETLVASDNVKGGEMAAAFIADKLGKGAKVAELEGVPGASATRERGSG
FHNIADQKLQVVTKQSADFDRTKGLTVMENLLQGHPDIQAVFAHNDEMALGALEAINSSG
KDILVIGFDGNKDALASIKDRKLSATVAQQPELIGKLATEAADDILHGKKVQKTISAPLK
LETQK
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaaaaaggctgtatccgtcattttaacgttatcattatttttgttaaccgcctgttcg
cttgagcctccccaatgggcaaagccatcaaactcggggaacaaaaaggaattcaccatt
ggcttgtccgtctcaacgcttaataatcctttttttgtctcattaaaaaagggtatcgaa
aaagaagctaaaaaacggggaatgaaagtcatcattgttgatgcacaaaatgattcatcg
aaacagacgagtgacgtggaagatttaattcagcaaggtgttgatgcattattaatcaac
ccgactgattcttcggcgatctcaacggcagtagaatctgcaaacgcagtcggtgtgccc
gtcgtaacaatcgatcgatctgcggaacaaggaaaagttgaaaccctcgttgcttccgat
aatgtaaaaggcggtgaaatggccgcggcgtttattgccgacaaacttggaaaaggagca
aaggtggcagagcttgaaggcgtccccggcgcatctgccacacgggaacgcggctcagga
ttccataacatcgcagaccaaaagctccaagttgtcacaaaacaatcagctgactttgac
cgcacgaaaggcctgactgtcatggaaaacctgctgcagggacatcctgatatccaagct
gtttttgctcacaacgatgaaatggcgctcggtgctctcgaggcaattaacagctcgggg
aaagacatattggtgatcggttttgacggcaataaagatgcgctcgcttccattaaagac
agaaagctgtcagccaccgtcgctcagcagcctgaattaatcggtaaattggctacagaa
gcagcagatgatattttgcacgggaaaaaagtgcaaaaaacaatatccgcgcctctcaaa
ctagaaacacaaaaataa

DBGET integrated database retrieval system