KEGG   Bacillus subtilis subsp. subtilis 168: BSU36640
Entry
BSU36640          CDS       T00010                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU36640 (ureC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU36640 (ureC)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    BSU36640 (ureC)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     BSU36640 (ureC)
SSDB
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3
Other DBs
NCBI-GeneID: 936958
NCBI-ProteinID: NP_391545
Pasteur: BG11983
BSORF: BG11983
UniProt: P77837 A0A6M4JPZ2
Position
complement(3766714..3768423)
AA seq 569 aa
MKMSREEYAELFGPTTGDKIRLGDTDLWIEVEKDFTVYGEEMIFGGGKTIRDGMGQNGRI
TGKDGALDLVITNVVLLDYTGIVKADVGVKDGRIVGVGKSGNPDIMDGVDPHMVIGAGTE
VISGEGKILTAGGVDTHIHFICPQQMEVALSSGVTTLLGGGTGPATGSKATTCTSGAWYM
ARMLEAAEEFPINVGFLGKGNASDKAPLIEQVEAGAIGLKLHEDWGTTPSAIKTCMEVVD
EADIQVAIHTDTINEAGFLENTLDAIGDRVIHTYHIEGAGGGHAPDIMKLASYANILPSS
TTPTIPYTVNTMDEHLDMMMVCHHLDAKVPEDVAFSHSRIRAATIAAEDILHDIGAISMT
SSDSQAMGRVGEVIIRTWQVADKMKKQRGALAGENGNDNVRAKRYIAKYTINPAITHGLS
HEVGSVEKGKLADLVLWDPVFFGVKPELVLKGGMIARAQMGDPNASIPTPEPVFMRQMYA
SYGKANRSTSITFMSQASIERGVAESLGLEKRISPVKNIRKLSKLDMKLNSALPKIEIDP
KTYQVFADGEELSCQPVDYVPLGQRYFLF
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaaaatgtcacgggaggaatatgcggaactgtttggcccgacaacgggcgataaaatc
agattgggcgacacggatttatggatcgaagtcgaaaaggatttcacagtatacggtgaa
gaaatgatctttggcggcggaaaaactatccgagacggcatgggccaaaacggcagaatc
acagggaaggacggcgctttggatttggttatcaccaacgtcgtgctattggattacaca
ggcattgtcaaagcggatgtcggtgtgaaagacggccggattgtcggtgtcggaaaaagc
ggaaatcctgatatcatggatggagtcgatccgcacatggtcatcggagcggggacagag
gtgatttccggtgaaggcaaaattttaacagccgggggagtggacacgcacattcatttt
atttgtcctcagcagatggaagttgcgctttcttcaggtgtgacgacccttttgggaggc
ggaacaggacccgctacaggaagcaaagcgacaacatgtacgtccggggcgtggtatatg
gcgaggatgctggaagcggccgaggagtttccgatcaatgtcggcttcttaggaaaaggg
aatgcatccgataaagcgccgctgatcgagcaggtggaagcaggcgccatcggtcttaag
ctccatgaagactggggaacgacgccaagcgccattaaaacgtgtatggaagtcgtggac
gaggctgatattcaagttgccatccataccgatacgattaacgaagcgggctttttggaa
aacacgctcgacgcgatcggggaccgggttattcatacttatcacattgaaggggcaggc
ggcggtcacgctccggatattatgaagctcgcctcttacgcgaacattctgccgtcatct
acaacgccaaccattccttataccgttaatacgatggatgagcatcttgacatgatgatg
gtctgccaccatttagatgcgaaagtgcctgaagatgtggcattcagccattccagaatc
agggcggcgacgattgccgcggaggatattctccatgatataggtgcgatcagcatgaca
tcatcggattcccaagcgatggggcgggtcggtgaagtgatcatccgaacatggcaggta
gccgataaaatgaaaaaacagcgcggcgctcttgccggtgaaaacgggaatgacaatgtg
cgcgcaaaacggtacattgccaaatacacgattaatccggcaattacgcacgggctcagc
catgaggtcggctcggtggaaaaagggaagcttgctgatctcgttctgtgggacccggta
tttttcggcgtgaaaccggaactggtcttaaagggcggcatgattgcacgtgcgcaaatg
ggagatccgaacgcgtccatcccgactcctgaaccggttttcatgcgccaaatgtatgcg
tcttacggaaaagccaaccgctcaacctcgattacatttatgtctcaggcaagcatagag
cgtggtgtggcggaaagcttagggctggaaaaaaggatttctccagtcaaaaatatcaga
aagctgagcaagctggatatgaagctgaattcggctttgccgaagattgagattgatcca
aaaacctatcaggtctttgctgacggggaggaattgtcttgccagcctgtcgattatgtc
ccacttggacaaagatatttcttattttga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36650
Entry
BSU36650          CDS       T00010                                 

Gene name
ureB
Definition
(RefSeq) urease subunit beta
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU36650 (ureB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU36650 (ureB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    BSU36650 (ureB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     BSU36650 (ureB)
SSDB
Motif
Pfam: Urease_beta
Other DBs
NCBI-GeneID: 936967
NCBI-ProteinID: NP_391546
Pasteur: BG11982
BSORF: BG11982
UniProt: P71035 A0A6M4JQ12
Position
complement(3768420..3768794)
AA seq 124 aa
MKPGAFQIAEGTITINEGREIREVTVKNTGSRSIQVGSHFHFAEANGALLFDRELAIGMR
LDVPSGTSVRFEPGEQKTVSLVEIRGRKTIRGLNGMADTFIDERGKEKTLANLKQAGWME
GVIR
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaagccgggagcatttcaaattgctgagggaaccattacgattaatgaaggccgtgag
atacgggaggtaacggtaaaaaacaccggatcacgctccattcaagtcggttcgcatttt
cattttgcggaggccaacggggctttattatttgaccgtgagctggcgatcggcatgcgt
cttgatgttccatcaggcacgtcggtccgttttgagccgggagagcagaaaacggtctca
ctagtggaaatcagaggacgcaagacaattagagggctgaacggaatggccgacacgttt
atcgatgaacgcggcaaagaaaaaacgttggccaacttaaaacaagccggctggatggag
ggtgtaatccgatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36660
Entry
BSU36660          CDS       T00010                                 

Gene name
ureA
Definition
(RefSeq) urease subunit gamma
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00220  Arginine biosynthesis
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU36660 (ureA)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSU36660 (ureA)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    BSU36660 (ureA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     BSU36660 (ureA)
SSDB
Motif
Pfam: Urease_gamma
Other DBs
NCBI-GeneID: 936968
NCBI-ProteinID: NP_391547
Pasteur: BG11981
BSORF: BG11981
UniProt: P75030 A0A6M3ZH40
Position
complement(3768791..3769108)
AA seq 105 aa
MKLTPVEQEKLLIFAAGELAKQRKARGVLLNYPEAAAYITCFIMEGARDGKGVAELMEAG
RHVLTEKDVMEGVPEMLDSIQVEATFPDGVKLVTVHQPISAEVKS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaaactgacaccagttgaacaagagaaattgctcatttttgcagcgggggaattagcc
aaacagcgaaaggcgcggggcgttctgctgaactatcctgaggctgctgcttatatcacc
tgctttattatggaaggcgcacgtgatgggaagggagtagcagagctgatggaagccggc
cgccatgtattaacggaaaaagatgtgatggagggtgtgcctgagatgctggacagcatt
caggtggaggccacatttccggatggtgtaaagcttgttacggtacatcagccaatttct
gcggaggtgaagtcatga

DBGET integrated database retrieval system