KEGG   Bacillus subtilis subsp. subtilis 168: BSU36800
Entry
BSU36800          CDS       T00010                                 
Symbol
atpC
Name
(RefSeq) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36800 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36800 (atpC)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36800 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DUF2642 DUF6286
Other DBs
NCBI-GeneID: 936994
NCBI-ProteinID: NP_391561
Pasteur: BG10822
UniProt: P37812 A0A6M3ZHD6
Position
complement(3781069..3781467)
AA seq 132 aa
MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEM
VAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELAL
QRALNRLDVAGK
NT seq 399 nt   +upstreamnt  +downstreamnt
atgaagaccgttaaagtcaatatcgttactcccgacggcccagtatacgatgcggatatc
gaaatggtgagtgtgagagccgaaagcggcgatctcggtattttgccaggccatattcca
accgtggctcctcttaaaatcggcgctgtccgtctgaaaaaagacgggcagactgaaatg
gttgccgtcagcggcggttttgtagaagtccgtcctgatcatgtcaccatccttgcccag
gctgccgagacagcggaaggcatcgataaagagcgcgctgaagctgcacgccagcgggcg
caggagcgtttgaattctcaatcagatgatactgacattcgtcgggctgagcttgcgtta
cagcgggctttgaacagattggatgtagcagggaaataa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36810
Entry
BSU36810          CDS       T00010                                 
Symbol
atpD
Name
(RefSeq) ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36810 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36810 (atpD)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BSU36810 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BSU36810 (atpD)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36810 (atpD)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase AAA NB-ARC T3SS_ATPase_C NACHT ABC_tran RNA_helicase AAA_16 AAA_7 AAA_19 ATPase_2 AAA_30 TrwB_AAD_bind ATPase
Other DBs
NCBI-GeneID: 936992
NCBI-ProteinID: NP_391562
Pasteur: BG10821
UniProt: P37809 A0A6M3ZHE1
Position
complement(3781491..3782912)
AA seq 473 aa
MKKGRVSQVLGPVVDVRFEDGHLPEIYNAIKISQPAASENEVGIDLTLEVALHLGDDTVR
TIAMASTDGVQRGMEAVDTGAPISVPVGDVTLGRVFNVLGENIDLNEPVPADAKKDPIHR
QAPSFDQLSTEVEILETGIKVVDLLAPYIKGGKIGLFGGAGVGKTVLIQELINNIAQEHG
GISVFAGVGERTREGNDLFYEMSDSGVINKTAMVFGQMNEPPGARMRVALTGLTMAEHFR
DVQGQDVLFFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTNVGSV
TSIQAIYVPADDYTDPAPATTFAHLDATTNLERKLTEMGIYPAVDPLASTSRALAPEIVG
EEHYAVAREVQSTLQRYKELQDIIAILGMDELGEEDKLVVHRARRIQFFLSQNFHVAEQF
TGQKGSYVPVKETVQGFKEILAGKYDHLPEDAFRLVGRIEEVVEKAKEMGVEV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaagaaaggacgcgttagccaggtattaggaccggtcgtcgacgtgcgttttgaagac
ggtcacttgcctgaaatttataatgcgattaaaatttcacagccagctgcaagtgaaaac
gaagtaggtattgatttaacgcttgaggtcgctcttcatttaggtgatgatacagtccgt
acaatcgcaatggcatctacagatggtgttcagcgcggtatggaagctgtagatacagga
gcgccaatctcagtaccggttggtgatgtaacacttggacgtgtatttaacgttctcgga
gaaaatattgatttgaatgagccggttcctgcggatgcgaaaaaggatccgattcacaga
caggcgccttcattcgatcagctttcaacagaagttgaaattcttgaaacaggtattaaa
gttgttgatttgcttgctccttacattaagggcggtaaaatcggattgttcggtggtgcc
ggtgtaggtaaaaccgtattaatccaggaattaatcaacaacatcgcgcaagagcacggc
ggtatctctgtattcgccggcgtaggagagcgtactcgtgaagggaacgaccttttctac
gaaatgagtgactctggcgtaatcaacaaaacagccatggtattcggacaaatgaacgag
ccgccgggcgcacgtatgcgtgttgctttgacaggccttacaatggctgagcacttccgt
gatgtacaaggacaggacgtactgttcttcatcgataacattttccgtttcacacaagcg
ggttcagaggtttcagcccttcttggccgtatgccttcagcggttggttatcagccgacg
cttgcaactgagatgggtcagctccaagagcgtatcacgtctacgaacgttggatcagtt
acatctatccaggcgatctacgtgcctgccgatgactacactgacccggcgccggcgaca
acgttcgctcacttggatgcgacaacaaaccttgagcgtaaattaactgaaatgggtatt
taccctgcggttgatccgttggcatctacatcacgcgcccttgctcctgaaattgttgga
gaagagcactatgcggttgcgcgtgaagtacagtcaacgcttcagcgttacaaagagctt
caggatatcattgcgattctcggtatggatgaattaggcgaggaagacaaacttgtcgtt
caccgcgcacgtcgtatccagttcttcctttctcagaacttccacgtggctgaacagttc
actggacaaaaaggttcttacgtgcctgtaaaagagacggtacaaggcttcaaagaaatc
ttagccggtaaatatgaccatcttccagaagatgcattccgtcttgtaggccgtatcgaa
gaagttgttgagaaagcaaaagaaatgggtgtagaagtttaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36820
Entry
BSU36820          CDS       T00010                                 
Symbol
atpG
Name
(RefSeq) ATP synthase gamma chain
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36820 (atpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36820 (atpG)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36820 (atpG)
SSDB
Motif
Pfam: ATP-synt GIT1_C
Other DBs
NCBI-GeneID: 936989
NCBI-ProteinID: NP_391563
Pasteur: BG10820
UniProt: P37810 A0A6M3ZGY1
Position
complement(3782938..3783801)
AA seq 287 aa
MASLRDIKSRITSTKKTSQITKAMQMVSAAKLNRAENNAKSFVPYMDKIQEVVSNVGRVS
GNVKHPMLLSREVKKTAYLVITSDRGLAGAFNSSVLRSAYQAMQERHQSKDEYAVIAIGR
VGRDFFKKREIPIISELTGLGDEVTFTEIKDLARQTIQMFIDGAFDELHLVYNHFVSAIT
QEVTEKKLLPLSDLGSGGGKRTASYEFEPSEEEVLEVLLPQYAESLIFGALLDSKASEHA
ARMTAMKNATDNAKELIDSLSLSYNRARQAAITQEITEIVGGAAALE
NT seq 864 nt   +upstreamnt  +downstreamnt
ttggcctcattacgcgatattaagtcaaggatcacgtcaacgaaaaaaacaagtcagatt
acaaaagccatgcagatggtatctgcggctaagctgaatcgtgctgaaaacaatgcaaaa
tcatttgtgccatatatggataaaatccaagaggttgtgtcaaacgtcggaagagtttcc
ggcaacgtgaagcacccgatgcttctcagcagagaagtgaaaaaaacggcataccttgtc
attacgtctgaccgcggtcttgccggcgcttttaacagttcggttttacggagtgcttat
caggccatgcaagaacgtcatcagtctaaggatgagtatgcggtgattgccatcggaaga
gtgggccgtgatttctttaagaaacgggagattccgatcatttccgagttaacaggactt
ggagatgaagtaacgtttacagaaattaaagatcttgcccgtcaaacgattcaaatgttt
atagacggtgcgtttgatgaattgcaccttgtttataaccattttgtcagcgccattact
caagaagtaacggagaaaaaacttctgccgttatctgatttgggcagcggcggcggaaaa
agaacggcgtcttatgaatttgaaccatctgaagaggaggttctggaggttttgcttcct
caatatgcagaaagcttaatcttcggtgcgcttcttgacagtaaagcaagtgagcacgct
gcaagaatgacggcgatgaaaaacgcgacagacaacgcgaaggaacttatcgattcactt
tcgctttcttacaaccgcgctcgccaagcagccatcacacaagaaattacggaaattgtc
ggcggagcagccgctttagaatag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36830
Entry
BSU36830          CDS       T00010                                 
Symbol
atpA
Name
(RefSeq) ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36830 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36830 (atpA)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BSU36830 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BSU36830 (atpA)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36830 (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N HAS-barrel Arginosuc_synth
Other DBs
NCBI-GeneID: 936995
NCBI-ProteinID: NP_391564
Pasteur: BG10819
UniProt: P37808 A0A6M4JQ33
Position
complement(3783878..3785386)
AA seq 502 aa
MSIKAEEISTLIKQQIQNYQSDIEVQDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVL
GMAQNLEESNVGIVILGPFSEIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGP
ILTSKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAI
DAILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPY
AGVTMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLER
AAKLSDAKGAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLFFSGVRPAINAG
LSVSRVGGSAQIKAMKKVSGTLRLDLASYRELEAFAQFGSDLDQATQAKLNRGARTVEVL
KQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHKDLLDGIAKTGN
LPADEDFKAAIEGFKRTFAPSN
NT seq 1509 nt   +upstreamnt  +downstreamnt
gtgagcatcaaagctgaagagattagcacgctgataaaacagcaaatacaaaattatcaa
tctgatattgaagttcaagacgtaggtacagtcatccaagtcggtgacggtattgcacgt
gtgcacggccttgacaactgtatggccggtgaacttgtcgaattttcaaacggtgttttg
ggtatggctcaaaaccttgaggaatcaaacgtaggtatcgtcatcttaggacctttcagt
gagatccgtgagggagacgaagtaaaaagaacaggccgcatcatggaggttcctgttggt
gaagagttaatcggccgtattgtaaacccgctaggccagccggttgacggactaggcccg
attctgacaagcaaaactcgtccgatcgaaagccctgcaccaggcgttatggaccgtaaa
tccgttcatgaaccgcttcaaaccggtatcaaagcgatcgatgcactgattccaatcggc
cgcggccagcgtgagctgatcatcggtgaccgtcaaacaggtaaaacatctgttgcgatc
gatgcgatcctgaaccaaaaagaccaagacatgatctgtgtatatgttgcgatcggccaa
aaagaatcaacagtccgcggcgtagtagaaacattgcgtaaacacggcgcgcttgattat
acaattgttgtaacggcgtctgcgtcacagccggcaccgcttctgtacctggcaccgtat
gctggggttacaatggcagaagaatttatgtacaacggcaagcacgttcttgttgtatac
gatgatctttctaaacaagcggccgcttaccgtgagctgtccttgcttcttcgccgtccg
ccaggccgtgaagcgttccctggggatgtattctatcttcattcccgtctgcttgagcgt
gcagcaaagcttagcgacgcgaaaggcgcaggatcaattacagctctgccgttcgtagaa
acacaagccggagatatctctgcttatattccgacgaacgtcatttccatcaccgacgga
cagatcttcctgcaatctgatttgttcttctcaggcgtacgtccagcgatcaatgccgga
ttgtctgtatcccgtgtcggcggctcagcgcaaatcaaagcgatgaaaaaagtatcaggt
actttgcgtcttgaccttgcgtcataccgtgagctggaagcattcgctcaattcggttct
gacctcgaccaagcgactcaggcaaaactgaaccgcggtgcgcgtacagttgaagtgctg
aagcaggatctgaacaagccgcttccggttgaaaagcaagtagctattctttatgcgctg
acaaaaggatatctcgatgatattcctgtggcggatatcagacgttttgaagaagagtac
tacatgtaccttgaccaaaaccataaagacctgcttgacggaattgcgaaaacaggaaac
cttcctgctgatgaagacttcaaagctgcaatcgaaggcttcaaacgcacatttgcacca
agcaactaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36840
Entry
BSU36840          CDS       T00010                                 
Symbol
atpH
Name
(RefSeq) ATP synthase subunit delta
  KO
K02113  F-type H+-transporting ATPase subunit delta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36840 (atpH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36840 (atpH)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36840 (atpH)
SSDB
Motif
Pfam: OSCP DUF4284
Other DBs
NCBI-GeneID: 936997
NCBI-ProteinID: NP_391565
Pasteur: BG10818
UniProt: P37811 A0A6M3ZH54
Position
complement(3785403..3785948)
AA seq 181 aa
MSGSAVSKRYASALFDIANESAQLNQVEEELIVVKQVFQNEKALNDVLNHPKVPAAKKKE
LIQNAFGSLSQSVLNTIFLLIDRHRAAIVPELTDEFIKLANVARQTEDAIVYSVKPLTDA
EMLPLSQVFAKKAGVASLRIRNEVQTDLIGGIKVRIGNRIYDGSVSGKLQRIERQLAGEN
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagtggatcagctgtctctaaacgatatgcatcagctctttttgatatagccaatgag
tccgctcagctgaatcaagtagaagaagagctaattgttgtaaaacaagtatttcaaaat
gaaaaagcgcttaatgatgtgttgaaccatccgaaggtgccggctgcgaagaaaaaagag
ctgattcaaaatgcatttggctctttgtcacagtccgtactcaatacgatttttcttttg
attgaccgccatcgtgccgcgattgtccctgagctcacagatgagtttatcaaactcgca
aatgtggcccgtcaaacagaagacgcaatcgtatattcagtgaaaccgctgacggatgca
gaaatgttaccattatcacaagtgtttgcaaaaaaagccggagtcgcttcactgagaatc
agaaatgaagtgcagacggatttaataggcggtattaaagtccgcattggaaaccggatt
tatgacggcagcgtaagcgggaagcttcagcgcattgaacgtcaattagccggggaaaat
cgatag

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36850
Entry
BSU36850          CDS       T00010                                 
Symbol
atpF
Name
(RefSeq) ATP synthase subunit b
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36850 (atpF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36850 (atpF)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36850 (atpF)
SSDB
Motif
Pfam: ATP-synt_B PEP-utilisers_N FUT8_N_cat PIN_8
Other DBs
NCBI-GeneID: 936998
NCBI-ProteinID: NP_391566
Pasteur: BG10817
UniProt: P37814 A0A6M3ZK01
Position
complement(3785945..3786457)
AA seq 170 aa
MSQLPLELGLSFNGGDILFQLLAMLILLALLKKYALGPLLNIMKQREDHIAGEITSAEEK
NKEAQQLIEEQRVLLKEARQESQTLIENAKKLGEKQKEEIIQAARAESERLKEAARTEIV
KEKEQAVSALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgtctcaattaccacttgaactaggattgtcgtttaacggcggagatatcctgttccaa
ctgttagctatgttaatcttattagcgcttctgaagaaatacgctttagggccgctatta
aacataatgaaacagcgtgaagaccacatcgctggagaaattacgtctgctgaagaaaaa
aataaagaagcgcagcagctgattgaagagcagcgcgttcttttaaaagaagcaagacag
gaatcccaaactcttatcgaaaacgcaaagaaactgggagagaagcaaaaagaagagatt
attcaggctgcacgtgcagaatctgaacgtctgaaagaagcagcaagaactgaaatcgtg
aaggaaaaggaacaggcggtttctgctctccgtgagcaagtagcgtctctttctgtcatg
attgcgtcgaaagtgatcgaaaaagaactggatgaacaagcgcaagagaaattgatccag
gactatcttaaagaggtaggagaaagccgatga

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36860
Entry
BSU36860          CDS       T00010                                 
Symbol
atpE
Name
(RefSeq) ATP synthase subunit c
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36860 (atpE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36860 (atpE)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36860 (atpE)
SSDB
Motif
Pfam: ATP-synt_C DUF3918
Other DBs
NCBI-GeneID: 936999
NCBI-ProteinID: NP_391567
Pasteur: BG10816
UniProt: P37815 A0A6M4JQ20
Position
complement(3786620..3786832)
AA seq 70 aa
MNLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFMGIALVEALPIIA
VVIAFLAFFG
NT seq 213 nt   +upstreamnt  +downstreamnt
atgaatttaatagcagctgcgattgcaattggtttaggcgcacttggtgcaggtattggt
aacggtttgattgtttcacgtacggtagaggggattgcccgtcagccggaagcaggtaaa
gaactgagaactcttatgttcatgggtatcgcattagttgaagcccttcctattatcgct
gtcgttatcgcattcttagcgttctttggctaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU36870
Entry
BSU36870          CDS       T00010                                 
Symbol
atpB
Name
(RefSeq) ATP synthase subunit a
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
bsu01100  Metabolic pathways
Module
bsu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU36870 (atpB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bsu00194]
    BSU36870 (atpB)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU36870 (atpB)
Photosynthesis proteins [BR:bsu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BSU36870 (atpB)
Chaperones and folding catalysts [BR:bsu03110]
 Other chaperones and cochaperones
  PapD
   BSU36870 (atpB)
SSDB
Motif
Pfam: ATP-synt_A
Other DBs
NCBI-GeneID: 937004
NCBI-ProteinID: NP_391568
Pasteur: BG10815
UniProt: P37813 A0A6M3ZLC2
Position
complement(3786878..3787612)
AA seq 244 aa
MNHGYRTIEFLGLTFNLTNILMITVASVIVLLIAILTTRTLSIRPGKAQNFMEWIVDFVR
NIIGSTMDLKTGANFLALGVTLLMYIFVSNMLGLPFSITIGHELWWKSPTADPAITLTLA
VMVVALTHYYGVKMKGLKEYSKDYLRPVPFMLPMKIIEEFANTLTLGLRLYGNIFAGEIL
LGLLAGLATSHYSQSVALGLVGTIGAILPMLAWQAFSLFIGAIQAFIFTMLTMVYMSHKI
SHDH
NT seq 735 nt   +upstreamnt  +downstreamnt
ttgaatcatggttacagaactatagaatttctaggtcttacttttaatctgacaaacatt
ctgatgattactgtggcgagtgtgattgttttattgattgctatattgacgacaagaacg
ctttcgatccgtcccggaaaagcccagaactttatggaatggattgttgatttcgtccgc
aatattattggcagtacaatggatttaaaaacaggggctaacttcttggcacttggtgtc
acattgctgatgtacatatttgtgtcgaatatgctggggctgccgttctctattacaatc
ggacatgagctctggtggaagtctccgacagccgatcctgccattacattaacgctagcc
gtgatggttgttgctttaacccactactatggtgtgaagatgaaagggctcaaggaatat
tccaaagactatttaagacctgttccattcatgctcccgatgaaaatcatcgaagagttt
gcgaatacgctgactctaggtttgcggctgtatggtaacatcttcgccggtgagattctt
ctcggcctgcttgcgggattagcaacaagccattattcgcaaagcgtggctctcggtctt
gtcggtacaatcggtgccattctgccgatgctggcatggcaagcattcagtttatttatt
ggtgctatccaggcatttatctttacaatgctgacgatggtgtacatgtctcataaaatc
agtcatgatcattaa

DBGET integrated database retrieval system