KEGG   Bacillus subtilis subsp. subtilis 168: BSU37270
Entry
BSU37270          CDS       T00010                                 

Symbol
narH
Name
(RefSeq) nitrate reductase beta chain
  KO
K00371  nitrate reductase / nitrite oxidoreductase, beta subunit [EC:1.7.5.1 1.7.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02020  Two-component system
Module
bsu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU37270 (narH)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37270 (narH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37270 (narH)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     BSU37270 (narH)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSU37270 (narH)
Transporters [BR:bsu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   BSU37270 (narH)
SSDB
Motif
Pfam: Fer4_11 Nitr_red_bet_C Fer4_10 Fer4_7 Fer4_9 Fer4_2 Fer4 Fer4_13 Fer4_8 Fer4_17
Other DBs
NCBI-GeneID: 937047
NCBI-ProteinID: NP_391608
Pasteur: BG11082
BSORF: BG11082
UniProt: P42176 A0A6M4JQ85
Position
complement(3824806..3826269)
AA seq 487 aa
MKIKAQIGMVMNLDKCIGCHTCSVTCKNTWTNRSGAEYMYFNNVETKPGIGYPKQWEDQD
KYKGGWTLKKGKLELKSGSKTNRLAGLFYNPNQPSIDDYYEPWNYDYETLTNSPQKKHQP
VARPKSSLTGDFMNIEWGPNWEDDLAGGHITGLEDPNVQKMEESIKTEFDDVFMMYLPRI
CEHCINPACVSSCPSGAMYKREEDGIVLVDQNACRSWRYCVSSCPYKKVYFNWQTNKAEK
CTLCFPRLEAGLPTICSETCVGRIRYLGVMLYDADKVEEAASVENEKDLYHSQLDVFLDP
NDPEVAKLAKEQGIPAEWIEAAQQSPIYKMIIDWKIALPLHPEYRTLPMVWYIPPLSPIM
NLFEGKGSRQTAEDIFPAIDQMRIPIDYLAQLLTAGDTDHIRSTLKKMSVMRQYMRAVQT
NKSIDPELISSVGLTEQQIEDMYRLLAIAKYDDRFVIPSSHREEVSDLYAEQGSCGLSFS
GGPGSCF
NT seq 1464 nt   +upstreamnt  +downstreamnt
ttgaagattaaagcgcaaatcggtatggtcatgaacttggataaatgcatcggctgccac
acgtgcagcgtcacctgcaaaaacacgtggacaaaccgttccggtgcggaatatatgtac
ttcaataatgtagaaacaaagccgggcatcggctacccgaagcaatgggaggaccaggac
aaatataaaggcggctggacattgaaaaaaggaaagctcgagctgaaatcgggctcgaaa
accaatcggcttgcaggccttttctataatccgaatcagccgtcaattgatgattactat
gaaccttggaactatgattatgaaacattaacgaacagcccgcagaaaaaacaccagccg
gtagcacgcccgaaatcgtccttgacgggggatttcatgaatatcgaatggggaccgaac
tgggaggacgatctcgcaggcggccacattacgggacttgaagatcccaacgtacaaaag
atggaggaatcgatcaaaacagaattcgatgacgtctttatgatgtatttgccccgtatt
tgcgagcactgcatcaacccggcatgcgtctcatcctgtccatccggcgccatgtacaaa
cgcgaggaggacggcattgtgcttgtggatcaaaacgcatgccgttcatggagatattgc
gtctcatcctgtccttataaaaaagtctattttaactggcaaacgaacaaagcggaaaaa
tgcacactctgctttccgcgtttggaggcgggactgccaaccatctgctctgagacgtgt
gttggcagaatccgctacctcggcgtcatgctatatgacgcggacaaagtggaggaagcg
gcatctgttgaaaatgaaaaggatctctaccattcccaattggacgtttttcttgatccg
aatgatcctgaggttgccaaactggcaaaagaacaaggcattccggctgaatggatagag
gccgcgcagcaatcaccgatctataaaatgatcattgactggaagatcgcgctgccgctt
catcctgagtaccgcacgctgccaatggtgtggtacattccgccgctcagcccgattatg
aatctctttgaaggaaaaggcagccggcaaacggcggaagatatttttccggctatcgac
caaatgagaatcccgatagattatttggcgcagctgttaacagccggtgatacggatcat
attcggtcaacattaaagaaaatgtctgtcatgcgccagtatatgagagcggtccagacg
aataaatcaatcgatccggaactgatctccagtgtcggcttaacagaacagcaaattgaa
gatatgtatcggctgcttgcgattgccaaatatgatgaccgctttgtgattccgagcagc
catcgagaagaagtatcagatttatacgctgaacaaggaagctgcggcttatcattttca
ggcggccccggctcctgtttctaa

KEGG   Bacillus subtilis subsp. subtilis 168: BSU37280
Entry
BSU37280          CDS       T00010                                 

Symbol
narG
Name
(RefSeq) nitrate reductase alpha chain
  KO
K00370  nitrate reductase / nitrite oxidoreductase, alpha subunit [EC:1.7.5.1 1.7.99.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu02020  Two-component system
Module
bsu_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BSU37280 (narG)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU37280 (narG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU37280 (narG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.5  With a quinone or similar compound as acceptor
    1.7.5.1  nitrate reductase (quinone)
     BSU37280 (narG)
   1.7.99  With unknown physiological acceptors
    1.7.99.-  
     BSU37280 (narG)
Transporters [BR:bsu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   BSU37280 (narG)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Nitr_red_alph_N Molybdop_Fe4S4
Other DBs
NCBI-GeneID: 938358
NCBI-ProteinID: NP_391609
Pasteur: BG11081
BSORF: BG11081
UniProt: P42175 A0A6M3ZH93
Position
complement(3826259..3829945)
AA seq 1228 aa
MKKKKRSPLFRRLNYFSPIEHHSNKHSQTTREDRDWENVYRNRWQYDKVVRSTHGVNCTG
SCSWNIYVKNGIVTWEGQNLNYPSTGPDMPDFEPRGCPRGASFSWYIYSPLRVKYPYVRG
VLINLWREALQTHQNPLEAWKSIVENPEKAKSYKQARGKGGFVRAEWPEVLKLISASLLY
TVMKYGPDRNVGFSPIPAMSMISHASGSRFMSLIGGPMLSFYDWYADLPPASPQIWGDQT
DVPESSDWYNSGYIITWGSNVPLTRTPDAHFLAEARYKGAKVISISPDFAESSKFADDWL
SIRQGTDGALAMAMGHVILQEFYVNQETERFIEYAKQYTDFPFLVTLSKENGVYTAGRFL
HAKDIGRKTKHDQWKPAVWDEQTSSFAIPQGTMGSRWDGQQKWNLHMIDEETGEPIEPRL
SVLGIEDEIGTVRIPYFSNDGNKVLERDLPIKKMNLNGEETYITTVFDLILANYGVNRGI
GERSAVSYDDPEPFTPAWQEQMTGIKKEAVVKIAREFAQNAIDTDGRSMIIVGAGINHWF
NSDTIYRAVLNLVLLVGAQGVNGGGWAHYVGQEKLRPAEGWQTIATAKDWEGVPKLQNGT
SFFYFATDQWRYEDQPISDLASPIAASSRYKHHADYNVLAARLGWLPSYPTFNQNGIDLY
KEAEKAGAATPEDVGAYVASQLQEKKLKFAIEDPDNEVNFPRNLFVWRANLISSSGKGHE
YFLKHLLGTTNGLMNDDSDSIRPEEIKWREQAPEGKLDLLINLDFRMAGTALYSDIVLPA
ATWYEKHDLSSTDMHPFIHPFAPAISAPWESKSDWDIFKALSKAVSDLAEEVDMEPVKEV
VATPLLHDTMQELAQPFGKINDWSKGECEAIPGKTMPNIQVVERDYKHIFHKMTALGPNV
ALKPSGTKGMSWSIADEYESLKQRLGEITSDSVAKGCPNISEAKQAAEAILTLSSTSNGK
VAVKAWESLENITNLKLKDLAEEREEECFTFEQITAQPKTVITSPAFTGSEKGGRRYSPF
TTNVEKLIPWRTLTGRQSYYVDHELMMEFGETMATFKPILQHRPFLSKRPDQEGKEIVLN
YLTPHNKWSVHSMYFDSLPMLTLFRGGPTVWMNKDDAEDTDIKDNDWIECFNRNGVVVAR
AVLSHRIPKGMAFMHHAQDRHINVPGTKLTNNRGGTHNSPTRIHVKPTQMIGGYAQLSYG
FNYYGPTGNQRDLNVVIRKLKEVDWLED
NT seq 3687 nt   +upstreamnt  +downstreamnt
atgaagaaaaagaaaaggagtccgttgtttaggagattgaattatttctctcctatcgaa
caccattcaaataaacatagccaaactacccgcgaggatcgcgattgggagaatgtatac
agaaacagatggcagtacgacaaagtcgttcgctccacccacggcgtcaactgtacaggg
tcttgcagctggaatatttatgtgaaaaacggaatagtcacgtgggaagggcaaaatttg
aattatccatcaacaggcccggatatgcctgattttgaaccgagaggctgcccgcggggg
gccagtttttcatggtatatctacagcccgctccgtgtgaaatatccatacgtgcgcggt
gtgctgatcaatttgtggcgggaggcattgcagacgcatcaaaatccattggaagcctgg
aaatcgatcgtcgaaaaccctgaaaaagcgaagtcctataaacaggcgagagggaaaggc
ggttttgtgcgcgctgaatggccggaggtgctgaagctgatttcagcctctctgctgtat
acagtgatgaaatacgggcctgaccgaaacgtcggtttttctccgattccggccatgtcc
atgatcagccacgcatcaggctcccggtttatgtcgttaatcggaggccctatgctcagt
ttttatgactggtatgcggatcttcctccagcatccccgcaaatttggggtgaccagacg
gacgttccggaaagcagtgattggtacaattccggctatattatcacatggggctccaac
gttccgttaacgagaacgcctgacgcgcattttttggcggaggcccgctataaaggcgct
aaggtcatttcgatcagtccagattttgcggaatcctcaaagttcgcggatgactggctg
agtattcgccaagggactgacggggcgcttgcgatggcgatgggtcacgttattctgcag
gaattttacgtgaaccaagaaactgaacgttttattgagtacgcgaagcaatacactgat
tttccatttctcgtcactctgtcaaaagaaaatggcgtatacacagcgggacggtttctg
catgcgaaggacatcgggcggaagacaaagcatgatcagtggaagcctgcggtttgggat
gaacagacaagttcatttgccataccccaagggacaatgggctcgcgctgggacgggcag
cagaaatggaacctgcacatgattgatgaagaaaccggggaaccgattgaaccccgtctc
tctgtgctgggaatagaggacgaaatcggcacggtgcgcatcccgtatttttcaaatgac
ggaaacaaagtgctcgagcgggatcttcctattaaaaaaatgaacctgaacggtgaagaa
acgtacatcacgaccgtgtttgacttgatactggctaactacggcgtgaaccggggcatc
ggcgaacgatcggctgtctcctatgatgaccctgagccgtttacgcctgcctggcaggaa
caaatgacaggaatcaaaaaagaagctgtcgttaagattgccagagagtttgcccaaaat
gcgatcgatacagacggccggtccatgattatcgtaggggccggcattaaccactggttc
aactccgacacgatctaccgagcagtgttaaatcttgttttacttgtaggcgcccaaggc
gtaaacggcggaggctgggcccattacgtggggcaggaaaagctccgacctgctgaaggg
tggcagacgattgcaactgcaaaggactgggaaggcgtgcccaagctgcaaaatggcacc
tcatttttctactttgcgacagatcagtggcgttatgaggaccagccgatcagtgatttg
gcatcaccgattgctgcttcatcccgctacaagcaccacgctgattacaatgtgctggcg
gcgcggctagggtggcttccgtcttacccgactttcaatcaaaatggcatcgatctgtat
aaagaagctgaaaaagcaggggcagcaacacctgaagacgtaggtgcgtacgtggcctca
cagctccaagagaaaaaactgaaattcgcgattgaagatcctgacaatgaagtgaatttc
ccaaggaatctctttgtatggcgggcaaatctgatctcaagctcaggaaaagggcatgaa
tattttctcaagcatttgctggggacaacgaacggtttaatgaatgacgacagcgacagc
atccgcccagaagaaatcaaatggcgggagcaggcgccggaaggaaagctcgacttatta
atcaatcttgattttcgaatggcgggtacggcgctgtattccgatatcgtgctgccggcg
gcgacatggtatgaaaaacacgatctcagcagcacagatatgcatccgttcattcatcca
tttgctcctgcgatctcggctccgtgggaatcgaagtcagactgggatattttcaaggcg
ctgtcaaaagccgtttccgatctggcagaagaagtcgatatggagccggtgaaagaagtg
gttgcgacaccgctgctccacgacaccatgcaggaattggcccagccattcggcaaaatc
aatgactggagcaaaggcgaatgtgaagccattccgggaaaaacgatgccgaacatccaa
gtcgttgaacgggattacaaacacatttttcataaaatgactgcacttggtccgaacgtt
gctttaaagccgagcggaacaaaagggatgagctggtcaatagccgatgaatatgaatca
ctcaaacagagactgggagaaatcacctcggacagcgtggcaaagggatgtccaaatata
agtgaagcaaagcaggctgcagaagcgattttaaccctatcatccacttcgaatggaaag
gtcgcagtaaaagcatgggaatcacttgaaaacatcacgaacctgaagctgaaagacctg
gcggaagaacgcgaggaagaatgctttacgttcgaacaaattacagcccagccgaaaacg
gtgatcacgtctccagcgtttaccggctctgaaaaaggagggcgcaggtattcgccgttt
acaacgaatgttgaaaaattaattccgtggcggacgctgacaggcagacaatcctattat
gtcgatcatgaactgatgatggaattcggtgaaacgatggcgacattcaaaccgatcctc
cagcatcgcccgtttctgagcaaacggcctgatcaagagggaaaagaaatcgtcctcaat
tatttgacgccgcataataaatggtctgtccacagcatgtattttgattctctgccgatg
ctgacgctgttccgcggcgggccgaccgtgtggatgaataaagatgatgcagaggacacg
gatatcaaagacaacgattggattgaatgcttcaaccgaaacggcgttgtcgtcgcgaga
gccgttttgtctcatcggattcctaaaggaatggcgtttatgcaccatgcccaggaccgc
cacatcaacgtgcccggcacaaagctgacgaataaccgcggaggcacccataacagcccg
acaaggattcacgtcaagccgacacagatgatcggtggctacgcccagctcagctacggc
tttaattattacggtccaacggggaatcagcgcgacctgaacgtcgtcatccgcaagctg
aaggaggtcgattggcttgaagattaa

DBGET integrated database retrieval system