KEGG   Bacillus subtilis subsp. subtilis 168: BSU37330
Entry
BSU37330          CDS       T00010                                 

Symbol
argS
Name
(RefSeq) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU37330 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU37330 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU37330 (argS)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU37330 (argS)
Enzymes [BR:bsu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BSU37330 (argS)
Amino acid related enzymes [BR:bsu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BSU37330 (argS)
Transfer RNA biogenesis [BR:bsu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BSU37330 (argS)
 Prokaryotic type
   Other AARSs
    BSU37330 (argS)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU37330 (argS)
SSDB
Motif
Pfam: DALR_1 tRNA-synt_1d Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f tRNA-synt_1
Other DBs
NCBI-GeneID: 937054
NCBI-ProteinID: NP_391614
Pasteur: BG11341
BSORF: BG11341
UniProt: P46906 A0A6M3ZH20
Position
complement(3833650..3835320)
AA seq 556 aa
MNIAEQMKDVLKEEIKAAVLKAGLAEESQIPNVVLETPKDKTHGDYSTNMAMQLARVAKK
APRQIAEEIVAHFDKGKASIEKLDIAGPGFINFYMNNQYLTKLIPSVLEAGEAYGETNIG
NGERVQVEFVSANPTGDLHLGHARGAAVGDSLCNVLSKAGYDVSREYYINDAGNQINNLA
LSVEVRYFEALGLEKPMPEDGYRGEDIIAIGKRLAEEYGDRFVNEEESERLAFFREYGLK
YELEKLRKDLENFRVPFDVWYSETSLYQNGKIDKALEALREKGHVYEEDGATWFRSTTFG
DDKDRVLIKKDGTYTYLLPDIAYHKDKLDRGFDKLINVWGADHHGYIPRMKAAIEALGYE
KGTLEVEIIQLVHLYKNGEKMKMSKRTGKAVTMRDLIEEVGLDAVRYFFAMRSADTHMDF
DLDLAVSTSNENPVYYAQYAHARICSMLRQGEEQGLKPAADLDFSHIQSEKEYDLLKTIG
GFPEAVAEAAEKRIPHRVTNYIYDLASALHSFYNAEKVIDPENEEKSRARLALMKATQIT
LNNALQLIGVSAPEKM
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaacattgcggaacaaatgaaggacgtgctgaaagaagaaatcaaagcggccgttctg
aaagcgggactggctgaagaaagccagattcccaatgttgttttagaaacaccgaaagat
aaaacacacggcgactactcaacgaatatggcgatgcagttggcaagagtggcaaaaaaa
gcgccgcgtcaaatcgctgaagagattgtcgcccattttgataaagggaaggcttcgatt
gaaaaactggatatcgccggcccgggttttatcaatttctatatgaacaatcaatattta
acaaagctgattccgtctgtactggaagcaggggaagcatacggggaaacgaacatcgga
aacggtgaacgagttcaggtagaattcgtatcagcgaatccgacgggagaccttcacctc
gggcatgcgcgcggggcggctgtcggcgattccttgtgcaacgtgctttcaaaagcgggt
tacgatgtaagccgcgaatactacattaacgatgcgggaaaccaaatcaacaatctggcg
ctttctgttgaagtccgttactttgaagcactcggattggaaaaaccgatgccggaggat
ggctaccgcggtgaggatatcattgcgatcggaaagcgtctcgctgaggaatacggtgat
cgtttcgttaacgaagaggaaagtgaacgcctcgcgtttttccgtgaatacggcctgaaa
tacgagctggaaaagcttcgcaaggacttggaaaacttccgtgtgccgtttgatgtgtgg
tattcagaaacttcactgtaccaaaatggaaaaatcgacaaggcgcttgaagcgctccgc
gaaaaaggccacgtctatgaagaagacggcgcgacttggttccgttccacgactttcggc
gatgataaagaccgcgtattgatcaagaaggacggcacgtacacgtaccttcttcctgat
atcgcgtatcataaggacaagcttgaccgcggctttgataagctgatcaacgtttggggc
gccgatcaccacggctacatcccgcgtatgaaagcggcaatcgaagcgctgggctatgaa
aaaggaacgcttgaagtagaaatcattcagctcgttcacctttacaaaaacggcgagaaa
atgaaaatgagcaaacggaccggtaaagccgtaacgatgcgtgacctgattgaagaagtc
ggcttggatgccgtgcgttacttctttgcaatgcgaagtgcagacacccatatggatttt
gacttagatcttgctgtatcaacatctaacgaaaaccctgtgtattatgcacaatacgcg
catgcccgtatttgcagcatgcttcgccaaggggaagagcaggggcttaaaccggcggca
gatcttgatttcagccatattcaatcagaaaaagaatacgatctgctgaaaacgatcggc
ggcttcccagaggcagtggcggaagcagcggaaaaacgaattccgcaccgtgtcactaac
tatatttatgatctggcttctgctctgcacagcttctacaacgcagagaaagtcatcgac
cctgaaaatgaagagaaaagccgcgcgcgcctggctttaatgaaggcaacgcaaattacg
ctgaacaatgcgcttcagctgatcggcgtatcggctccggaaaaaatgtaa

DBGET integrated database retrieval system