KEGG   Bacillus subtilis subsp. subtilis 168: BSU38190
Entry
BSU38190          CDS       T00010                                 

Symbol
galT
Name
(RefSeq) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
bsu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU38190 (galT)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU38190 (galT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     BSU38190 (galT)
SSDB
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf DUF4922
Other DBs
NCBI-GeneID: 937307
NCBI-ProteinID: NP_391698
Pasteur: BG10582
BSORF: BG10582
UniProt: P39575 A0A6M3ZHA0
Position
complement(3919093..3920634)
AA seq 513 aa
MSIIEHLEQLLEYGLERKLISIWDREYTRNRLYEALGITHPEPNSSTSIKQSQSLPDLLA
PIYKWAAETGRMEADTDTYRDLLSAKLMGCFVPAPSEVIRKFEETKALYGPKQATKEFYQ
YSEDVYYIRTDRIAKNVHWTVPTEYGELEMTINLSKPEKDPKAIAAAKEQEQTNYPMCLL
CKENVGFEGSVNHPARQNHRIIPVILEDEQWFLQFSPYVYYPEHCIVLKGEHEPMEISKK
TFERLLSFLGQYPHYFIGSNADLPIVGGSILSHDHFQGGAHDFPMARAEAEDVYELNDYP
GVSLGLVKWPMSVLRLQGDEPGHVAEAADHIFRTWQTYSDEKAGIAAYTGDTPHNTVTPI
ARRRGDLYELDIVLRNNRTDEEHPLGIFHPHQEVHHIKKENIGLIEVMGLAILPGRLQEE
MKETAAALCSADPKTALEQNPLTAKHSEWALRTMEKRTITKENVDLVIKEELGHVFARIL
EHAGVFKQTAEGKQAFRRFIDQLGAKPVKSLNR
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgagtattattgaacatctggaacagctgcttgagtatggcctggaacgaaaattgatt
tcgatctgggatcgggaatatacgagaaaccgtctttatgaagcgctgggcatcacacat
cccgagccgaactccagcaccagcatcaagcagtcacaaagcctgccggacttgctagct
cccatctataaatgggctgccgaaaccggccgaatggaagcggatacagatacgtaccgt
gacctgctcagcgcaaagctgatgggctgttttgtgcctgccccgtccgaggtcattcgc
aaatttgaagagacaaaagcattatacggcccaaaacaggcgacaaaggaattctatcaa
tattcagaggatgtctattatatacggactgacagaatcgccaaaaatgttcattggacg
gtgccgaccgaatatggcgagctggaaatgaccattaacctatcaaagcctgaaaaggac
ccgaaagcgattgcggctgcaaaagagcaggaacagacaaattatccgatgtgtttgctg
tgtaaagaaaatgtcggcttcgagggaagcgtgaatcatccagcccggcaaaatcacaga
atcattccggtcatccttgaggacgaacaatggttcctgcaattctcgccatatgtctat
tatccggagcactgcattgtcttaaaaggtgaacatgaaccgatggagatcagcaaaaaa
acatttgaaaggctgctgtcatttcttggccaatatccgcattattttatcggttcaaac
gcggatctgccgattgtcggcggcagcatcctaagccatgatcatttccaaggcggcgcg
catgattttccaatggcacgtgcagaagcggaagacgtttatgaattaaatgattatccc
ggcgtgtcgctgggcttagtgaagtggccgatgtctgtgctcaggctccaaggagacgaa
ccgggtcatgtcgccgaagctgctgaccatatcttccgcacgtggcagacgtattccgat
gaaaaagccggcattgccgcctatacaggcgatacgccccataatacggtcacaccgatt
gcgcggcgcaggggagacttgtacgaactcgatatcgtactgaggaacaaccggacggat
gaggagcatccattaggaatatttcatcctcatcaagaagtccaccatattaaaaaagaa
aatatcggcctgattgaggtcatgggattggcgatattgcctggccgcttacaggaggaa
atgaaagaaacggcagcggcgctatgttctgctgatccgaaaacagccttagaacaaaat
ccgctcactgcaaagcatagtgagtgggctcttcggacgatggaaaaaagaaccataaca
aaagagaacgtagatctagtcataaaagaagagctgggacatgtattcgcgcgcatcctt
gaacacgccggtgtatttaagcagacagcagagggaaaacaggccttcagaaggttcatc
gatcagttgggcgccaaaccagtcaaaagcctcaaccgctag

DBGET integrated database retrieval system