KEGG   Bacillus subtilis subsp. subtilis 168: BSU38200
Entry
BSU38200          CDS       T00010                                 

Symbol
galK
Name
(RefSeq) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
bsu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU38200 (galK)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU38200 (galK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU38200 (galK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     BSU38200 (galK)
Exosome [BR:bsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSU38200 (galK)
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-GeneID: 937297
NCBI-ProteinID: NP_391699
Pasteur: BG10581
BSORF: BG10581
UniProt: P39574 A0A6M3ZHQ0
Position
complement(3920638..3921810)
AA seq 390 aa
MREELKGIFASVFGEKEGLRFFFAPGRVNLIGEHTDYNGGHVFPCALTMGTYAAVAERND
GLVRMYSDNFRNAGIKECSLDDIRYQKEDDWANYPKGVIYEFQQRGYAVPHGFDIVFSGN
IPNGAGLSSSASIELLMGVVLQSYFHPEVDALELVKMAQHAENHFIGVNCGIMDQFAIGM
GKKHHAMLLNCDTLDYEYSKLNVSGLALVIANTNKKRTLADSSYNTRRQECNDALLDLKK
GLDIAALGDIKPSDFDAHSSLIQNETNRRRAKHAVYENHRAIKTAHMFKENNIDEIGQLM
KESHLSLKDDYEVTCPELDELVFAAWDHEGVIGSRMTGAGFGGCTISIVKDEFVDDFIQK
VGDRYQEKTGLRADFYVADIGEGARELKGE
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcgggaagagctaaaggggatatttgcaagtgtattcggagaaaaagaggggttacgg
ttttttttcgcacctggaagagtgaatctgattggagaacatacagactataacggcggg
catgtctttccgtgcgcgctgacaatgggtacatatgctgctgttgcagaaagaaacgac
gggcttgtccggatgtattcagataactttagaaacgcaggcatcaaggaatgcagcctt
gacgacattcgctatcaaaaagaagacgactgggcgaactacccaaaaggcgtgatttat
gaatttcaacagaggggatatgcagttccccatggctttgacattgtattttcagggaat
attccaaacggggcgggactgtcgtcttccgcttctattgaactgctgatgggggtcgtg
ctccaaagttattttcatcctgaagtagatgcgcttgagcttgtgaaaatggcgcagcat
gcggaaaaccattttatcggcgtcaattgcggaattatggaccaatttgcaattggaatg
gggaaaaaacatcatgcgatgctgctgaactgtgacacgcttgactatgaatatagcaaa
ctcaatgtctcaggcctcgcgctggtcatcgcgaacacgaacaaaaaaaggacattggct
gactccagctataatacgagacgccaagaatgcaatgatgcattgcttgatctgaaaaaa
ggcctcgatattgccgcactgggcgacatcaagccttctgatttcgatgcgcattccagc
ctgatccaaaatgaaacgaacagacgccgggcaaagcacgctgtatacgaaaatcatcgt
gctattaagacggcccatatgttcaaagagaacaatatagatgaaatcgggcagttaatg
aaggaatcccacctttcattgaaggatgactatgaagtaacatgccctgaacttgatgag
cttgtgtttgcggcatgggatcacgaaggtgtaattggatcaagaatgacgggagcaggc
tttggcggctgcaccatcagcattgtaaaagatgagttcgttgatgattttattcagaag
gttggagacagatatcaagaaaaaacagggctccgagcggacttttatgtcgcggatatc
ggagagggagcgagagaactaaagggggagtga

DBGET integrated database retrieval system