KEGG   Bacillus subtilis subsp. subtilis 168: BSU38860
Entry
BSU38860          CDS       T00010                                 

Symbol
galE
Name
(RefSeq) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00052  Galactose metabolism
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu00541  O-Antigen nucleotide sugar biosynthesis
bsu01100  Metabolic pathways
bsu01250  Biosynthesis of nucleotide sugars
Module
bsu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BSU38860 (galE)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU38860 (galE)
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BSU38860 (galE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     BSU38860 (galE)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short NAD_binding_10 KR NAD_binding_4 NmrA UDPG_MGDP_dh_N 3HCDH_N
Other DBs
NCBI-GeneID: 937420
NCBI-ProteinID: NP_391765
Pasteur: BG11837
BSORF: BG11837
UniProt: P55180 A0A6M4JQM3
Position
complement(3989948..3990967)
AA seq 339 aa
MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL
DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV
FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPF
GAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAE
GHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFA
DPAKAKRELGWEAKRGLEEMCADSWRWQSSNVNGYKSAE
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcaatacttgttactggcggtgccggttacattggcagccacacatgtgttgaacta
ttgaacagcggctacgagattgttgttcttgataatctgtccaacagttcagctgaagcg
ctgaaccgtgtcaaggagattacaggaaaagatttaacgttctacgaagcggatttattg
gaccgggaagcggtagattccgtttttgctgaaaatgaaatcgaagctgtgattcatttt
gcagggttaaaagcagtcggcgaatctgtggcgattcccctcaaatattatcataacaat
ttgacaggaacgtttattttatgcgaggccatggagaaatacggcgtcaagaaaatcgta
ttcagttcatctgcgacagtatacggcgttccggaaacatcgccgattacggaagacttt
ccattaggcgcgacaaatccttatgggcagacgaagctcatgcttgaacaaatattgcgt
gatttgcatacagccgacaatgagtggagcgttgcgctgcttcgttactttaacccgttc
ggcgcgcatccaagcggacggatcggtgaagacccgaacggaatcccaaataaccttatg
ccgtatgtggcacaggtagcagtcgggaagctcgagcaattaagcgtattcggaaatgac
tatccgacaaaagacgggacaggcgtacgcgattatattcacgtcgttgatctcgcagaa
ggccacgtcaaggcgctggaaaaagtattgaactctacaggagccgatgcatacaacctt
ggaacaggcacaggctacagcgtgctggaaatggtcaaagcctttgaaaaagtgtcaggg
aaagaggttccataccgttttgcggaccgccgtccgggagacatcgccacatgctttgca
gatcctgcgaaagccaagcgagaactaggctgggaagcgaaacgcggccttgaggaaatg
tgtgctgattcctggagatggcagtcttctaatgtgaatgggtataagagtgcggaataa

DBGET integrated database retrieval system