KEGG   Bacillus subtilis subsp. subtilis 168: BSU40500
Entry
BSU40500          CDS       T00010                                 

Symbol
rplI
Name
(RefSeq) 50S ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU40500 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU40500 (rplI)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU40500 (rplI)
  Bacteria
    BSU40500 (rplI)
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N DUF2465
Other DBs
NCBI-GeneID: 937830
NCBI-ProteinID: NP_391930
Pasteur: BG10009
BSORF: BG10009
UniProt: P37437 A0A6M3ZI30
Position
complement(4163197..4163646)
AA seq 149 aa
MKVIFLQDVKGKGKKGEVKNVADGYAHNFLIKKGLAVEANASNISALNGQKQKEKKEAIA
ELEQAKSLKETLEKLTVELSAKSGEGGRLFGSVTSKQITEQLQKDHNIKVDKRKLELPDG
IRALGYTNVPVKLHPEVQAVLKVHVKEEA
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaaggttattttcttacaagatgtaaaaggaaaaggaaaaaaaggcgaagtcaaaaac
gtagcagacggttatgcgcataactttctaattaaaaaaggcctcgcggttgaagcgaac
gcgtcaaacatcagcgcgttaaacggacaaaagcagaaagagaaaaaagaagccattgct
gagcttgagcaggctaagagcttgaaagagacattagaaaaactgactgttgagcttagc
gcaaaatcaggtgagggcggccgtttatttggttcagtgacaagcaagcaaatcactgaa
cagctccaaaaagaccataacattaaagtagataagcggaagcttgaactgccggacggc
attcgtgcattaggatatacaaacgtgcctgtgaagctgcatcctgaagtgcaggctgtg
ttaaaggtacatgtaaaagaagaagcttaa

DBGET integrated database retrieval system