KEGG   Bacillus subtilis subsp. subtilis 168: BSU40910
Entry
BSU40910          CDS       T00010                                 

Symbol
rpsF
Name
(RefSeq) 30S ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU40910 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU40910 (rpsF)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU40910 (rpsF)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    BSU40910 (rpsF)
  Bacteria
    BSU40910 (rpsF)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU40910 (rpsF)
SSDB
Motif
Pfam: Ribosomal_S6 AbiJ_NTD3 NAS
Other DBs
NCBI-GeneID: 937919
NCBI-ProteinID: NP_391971
Pasteur: BG10049
BSORF: BG10049
UniProt: P21468 A0A6M4JR76
Position
complement(4199445..4199732)
AA seq 95 aa
MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY
QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE
NT seq 288 nt   +upstreamnt  +downstreamnt
atgagaaagtacgaagttatgtacattatccgcccaaacattgacgaagagtctaaaaaa
gcagttatcgagcgtttcaacaacgttctgacttctaacggtgcggagatcactggaaca
aaggattggggtaaacgtcgtcttgcttacgaaatcaacgatttccgcgacggtttctac
caaatcgtaaacgttcaatctgacgctgcggcagttcaagaatttgaccgtctagctaag
atcagtgacgatatcattcgccacattgttgttaaagaagaagaataa

DBGET integrated database retrieval system