KEGG   Bacillus subtilis subsp. subtilis 168: BSU41060
Entry
BSU41060          CDS       T00010                                 

Symbol
rpmH
Name
(RefSeq) 50S ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BSU41060 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsu03011]
    BSU41060 (rpmH)
Ribosome [BR:bsu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BSU41060 (rpmH)
  Bacteria
    BSU41060 (rpmH)
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-GeneID: 937942
NCBI-ProteinID: NP_391986
Pasteur: BG10064
BSORF: BG10064
UniProt: P05647 A0A6M4JRB3
Structure
PDB: 
6PVK 6PPF 6PPK 3J3W 3J3V

Position
complement(4215255..4215389)
AA seq 44 aa
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
NT seq 135 nt   +upstreamnt  +downstreamnt
atgaaaagaacattccaaccgaataaccgtaaacgcagcaaagttcatggcttcagaagc
cgtatgagttcaaaaaacggtcgtctagttttagcacgccgtcgccgcaaaggcagaaaa
gtattatcagcttag

DBGET integrated database retrieval system