KEGG   Bacillus subtilis subsp. subtilis AG1839: BSUB_02149
Entry
BSUB_02149        CDS       T03442                                 
Symbol
sspC
Name
(GenBank) small acid-soluble spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bsut  Bacillus subtilis subsp. subtilis AG1839
Brite
KEGG Orthology (KO) [BR:bsut00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSUB_02149 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: AIC44663
Position
2129007..2129225
AA seq 72 aa
MAQQSRSRSNNNNDLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atggctcaacaaagtagatcaagatcaaacaacaataatgatttactaattcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacatctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagctcaacaaaacatgggcggtcaatttcattaa

DBGET integrated database retrieval system