Bacillus subtilis XF-1: C663_0427 Help Entry C663_0427         CDS       T02459                                  Symbol mutT Name (GenBank) mutator protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism bsx  Bacillus subtilis XF-1 Brite KEGG Orthology (KO) [BR:bsx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bsx03400]     C663_0427 (mutT) Enzymes [BR:bsx01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      C663_0427 (mutT) DNA repair and recombination proteins [BR:bsx03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     C663_0427 (mutT)  Prokaryotic type     C663_0427 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like NUDIX_2 Motif Other DBs NCBI-ProteinID:  AGE62283 Position 481650..482108 Genome browser AA seq 152 aa AA seqDB search MAGDTQGAFVIALNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAAVREVLEETGYNAA LSAKIGVYLRPKFQDEQHVFFGSITGGQAMANGTETAGLKWVSPGRLPLFMVPNRKRQIN DFKNGAQDVNVTVKDSGLLAAIDLLKRRLGKR NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcgggggatacacaaggggcttttgtgatcgcactgaacgaaagtcagcaaattctg ctggtgaaacgaaaagatgtccctctatgggatttgccgggcggcagggttgatcccggg gaatcggctgaggaagcggcagtgcgggaggtattggaagaaacgggatacaatgcagcg ctttctgcgaaaataggtgtttacctaaggccaaagtttcaagatgaacagcatgtgttt ttcggaagcataacaggcggacaagcaatggctaacggcacagagacagcgggattaaag tgggtttctccggggcgtttgccgctttttatggtgccgaaccgaaaaaggcagatcaat gatttcaaaaacggcgctcaagatgtaaatgtcaccgtcaaggatagcgggttgctcgcg gcgatcgacctgttgaaaagaagactgggcaagcgataa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system