KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH3692
Entry
CT43_CH3692       CDS       T01838                                 

Definition
(GenBank) UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00541  O-Antigen nucleotide sugar biosynthesis
btc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    CT43_CH3692
Enzymes [BR:btc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     CT43_CH3692
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 adh_short
Other DBs
NCBI-ProteinID: AEA17358
Position
complement(3709731..3710642)
AA seq 303 aa
MKKNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRAHREKIRNGITCNLTNKSEVMK
VMKQIKPDYVLHLAGRNSVIESWTAALEYIEINVIGTLYLLEAIKQEASHCRTLVIGSAL
QADSMNEIKISNPYSLSKTMQVIIAEAWGGLMDSNIIIAKPSNLIGPGESNGICSILAKK
MIDIESGRSKAIIEVNSLKDSRDFLDVRDAIKAYHVLLRDGINGTQYNIGSGVKRSLLNV
LEQYKELTQLNFFIEETEKNGSDSNESLAIEEIKRLGWIPEIEFHQSLKDVLEYAKCSDI
CMQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgcgagccttttaataactggtgcaaatggtttcacaggacgccatgct
tgccaatattttttagagcagggctttcatgtaattcctatgtttcaaaatcgtgcacat
agagaaaaaattagaaatggtattacttgtaatttaactaataagagcgaagtaatgaag
gtaatgaaacaaataaagccagactacgtattgcatttagcaggaaggaattcggttata
gaatcttggacagctgctcttgagtatatagagattaatgtaataggaacgttatattta
ttagaagcaattaagcaagaagcctcgcattgtagaacattagttataggatctgctttg
caagcagatagtatgaacgaaataaaaatttcaaatccatatagtttaagtaaaacgatg
caagtcattattgcagaggcttggggaggattaatggattcaaatattatcattgcaaag
ccctcaaacttaattggtccaggggaatcgaatggcatttgttcgattctcgcaaagaaa
atgatagatatagaatcaggtagaagtaaagccattattgaagtaaacagtttgaaagat
agtagagattttctagatgtacgtgatgcgattaaagcgtatcatgtgttattacgagat
ggaataaatggaacacaatataatatcggatcaggagtaaaacgatctttattaaatgta
ctagaacaatataaagaattaacacagctaaatttttttatagaggaaacagagaaaaat
gggagcgactcaaatgagagtttagcaatagaggaaataaaaaggttaggttggatccca
gaaattgaatttcatcaatcattaaaagatgtacttgagtatgcgaagtgtagtgacatc
tgcatgcaatga

DBGET integrated database retrieval system