KEGG   Bacillus tequilensis: G4P54_09135
Entry
G4P54_09135       CDS       T07089                                 

Definition
(GenBank) hypothetical protein
  KO
K06354  phosphatase RapE regulator
Organism
bteq  Bacillus tequilensis
Pathway
bteq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bteq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    G4P54_09135
Motif
Pfam: ATP19
Other DBs
NCBI-ProteinID: QIW79956
UniProt: A0A6H0WKS2
Position
complement(1730760..1730903)
AA seq 47 aa
MKFKLALATLSVVVGLAIFSGFSSSNDKEFHEAKRNITSIQPTKFFV
NT seq 144 nt   +upstreamnt  +downstreamnt
atgaaatttaaacttgcattagccaccttgtcagttgtcgttggattagcaatttttagt
ggcttttcatcctcgaatgacaaagagttccatgaagctaaaaggaatattacttctatt
caaccgaccaagttttttgtttaa

DBGET integrated database retrieval system