KEGG   Bacillus tequilensis: G4P54_09905
Entry
G4P54_09905       CDS       T07089                                 
Symbol
sspC
Name
(GenBank) acid-soluble spore protein SspC
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
bteq  Bacillus tequilensis
Brite
KEGG Orthology (KO) [BR:bteq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    G4P54_09905 (sspC)
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: QIW80096
UniProt: A0A6H0WL68
Position
complement(1838726..1838944)
AA seq 72 aa
MPQQSRSRSNNNNELLVPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLV
RLAQQNMGGQFH
NT seq 219 nt   +upstreamnt  +downstreamnt
atgcctcaacaaagcagatcaagatcaaacaacaataatgagttattagttcctcaagca
gcttcagctattgaacaaatgaaacttgaaatagcttctgagtttggtgttcaattaggc
gctgagactacttctcgtgcaaacggttcagttggtggagaaatcactaaacgtttagtt
cgcttagcacaacaaaatatgggcgggcaatttcattaa

DBGET integrated database retrieval system