KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_18375
Entry
YBT020_18375      CDS       T01839                                 

Definition
(GenBank) UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
btf00541  O-Antigen nucleotide sugar biosynthesis
btf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    YBT020_18375
Enzymes [BR:btf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     YBT020_18375
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 adh_short Synapsin
Other DBs
NCBI-ProteinID: ADY22903
Position
complement(3595060..3595971)
AA seq 303 aa
MKKNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRTHREKNENGITCNLTNKSEVMK
VMKQIKPDYVLHLAGRNSVIESWTAALEYVEINVIGTLYLLEAIKQEASHCRTLVIGSAL
QADSINEIKISNPYSLSKTMQVIIAEAWGELMGSNIIIAKPSNLIGPGVSNGICSILAKK
MIDIESGRSKAIIEVNSLKDSRDFLDVRDAVKAYHVLLRDGINGKQYNIGSGVKRSLLEV
LEQYKELTQLNFFIEETEKSGSDSNDSLVIEEIKRLGWIPEIQFHQSLKDVLEYEKCSDI
CMQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgcgagccttttaataactggtgcaaatggttttacaggacgccatgct
tgccaatattttttagaacagggctttcatgtaattcctatgtttcaaaatcgtacacat
agagaaaaaaatgaaaatggtattacttgtaatttaacgaataagagcgaagtaatgaag
gtaatgaaacaaataaagccagattatgtattacatttagccggtaggaattcagtcata
gagtcttggacagctgctcttgaatatgtagaaattaatgtaatagggacgttatattta
ttagaagcaattaagcaagaagcctcgcattgtagaacattagttataggatctgctttg
caagcagatagtataaacgaaataaaaatttcaaatccatatagtttaagtaaaacgatg
caagtcattattgcagaggcttggggcgaattaatgggttcaaatattatcattgcaaag
ccctcaaacttaattggtccaggagtatcaaatggcatttgttcgattctcgcaaaaaaa
atgatagatatagaatcaggtagaagtaaagccattattgaagtaaacagtttgaaagat
agtagggattttctagatgtacgtgatgcggttaaagcgtatcatgtgttattacgagat
ggaataaatggaaaacagtataatatcggatcaggagtgaaacgatctttattagaggta
ctagaacaatataaagaattaactcagctgaattttttcatagaggaaacagaaaaaagt
gggagtgattcaaatgatagtttagtaatagaggaaataaaaaggttaggttggatccca
gaaattcaattccatcaatcattaaaagatgtacttgagtatgagaagtgtagtgacatc
tgcatgcaatga

DBGET integrated database retrieval system