KEGG   Bacteroides thetaiotaomicron VPI-5482: BT_3862
Entry
BT_3862           CDS       T00122                                 
Name
(GenBank) endo-alpha-mannosidase
  KO
K21132  alpha-mannan endo-1,2-alpha-mannanase / glycoprotein endo-alpha-1,2-mannosidase [EC:3.2.1.198 3.2.1.130]
Organism
bth  Bacteroides thetaiotaomicron VPI-5482
Brite
KEGG Orthology (KO) [BR:bth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BT_3862
Enzymes [BR:bth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.130  glycoprotein endo-alpha-1,2-mannosidase
     BT_3862
    3.2.1.198  alpha-mannan endo-1,2-alpha-mannanase
     BT_3862
SSDB
Motif
Pfam: Glyco_hydro_99 Glyco_tran_WbsX
Other DBs
NCBI-ProteinID: AAO78967
UniProt: Q8A109
Structure
Position
5030403..5031551
AA seq 382 aa
MRKELVFVLLALFLCAGCNGNKKKMNGEHDLDAANITLDDHTISFYYNWYGNPSVDGEMK
HWMHPIALAPGHSGDVGAISGLNDDIACNFYPELGTYSSNDPEIIRKHIRMHIKANVGVL
SVTWWGESDYGNQSVSLLLDEAAKVGAKVCFHIEPFNGRSPQTVRENIQYIVDTYGDHPA
FYRTHGKPLFFIYDSYLIKPAEWAKLFAAGGEISVRNTKYDGLFIGLTLKESELPDIETA
CMDGFYTYFAATGFTNASTPANWKSMQQWAKAHNKLFIPSVGPGYIDTRIRPWNGSTTRD
RENGKYYDDMYKAAIESGASYISITSFNEWHEGTQIEPAVSKKCDAFEYLDYKPLADDYY
LIRTAYWVDEFRKARSASEDVQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaggaaagaacttgtttttgttttattggcattatttctgtgtgccggctgtaacggt
aacaaaaagaaaatgaacggtgaacacgatttggatgcggcaaacattacgttggatgac
catacgatcagtttttattataattggtatggaaatccgtcagtggatggagaaatgaag
cactggatgcacccgatagcccttgctccgggacattcgggagatgtcggtgccatatcc
ggacttaatgatgacatcgcctgtaatttttatccggagctcggaacgtacagcagcaat
gatcctgaaatcattcggaaacatatccggatgcatataaaagcgaatgtcggtgtactg
tctgtcacttggtggggagaaagcgattatggcaaccaaagtgtgtctctcctgctggat
gaggctgcaaaagtaggggcaaaggtgtgctttcatatagagccttttaatggacgcagc
ccgcaaacggtaagggagaatattcaatatatagtggatacttatggtgatcatccggct
ttttaccgtacgcacggcaaacctcttttctttatctatgattcttatctgatcaaacct
gccgagtgggcgaagttgtttgctgccgggggagagataagtgtgcgtaataccaagtac
gacggtctttttattggtctgacattgaaggaaagcgagttgcccgacattgagacagcg
tgcatggatggcttttacacttactttgccgcaacaggtttcacaaatgcttctactccg
gccaactggaaatccatgcagcaatgggcaaaggcacataataaattgtttattccgagt
gtcggtccgggatatattgatacccggattcgtccttggaacggaagtaccacccgagac
cgtgagaatggaaaatattacgatgatatgtataaagctgccatagaaagcggtgcttct
tatatttcgattacgtctttcaatgaatggcatgaaggaactcagatagagccggctgtc
tcaaagaagtgcgatgcttttgaatatttggattataaaccattggctgatgattactat
ttgataagaactgcctattgggtagatgaattccggaaagcaagatctgcttcggaagat
gttcaataa

DBGET integrated database retrieval system