KEGG   Bacteroides thetaiotaomicron 7330: Btheta7330_00449
Entry
Btheta7330_00449  CDS       T04540                                 
Name
(GenBank) hypothetical protein
  KO
K21132  alpha-mannan endo-1,2-alpha-mannanase / glycoprotein endo-alpha-1,2-mannosidase [EC:3.2.1.198 3.2.1.130]
Organism
btho  Bacteroides thetaiotaomicron 7330
Brite
KEGG Orthology (KO) [BR:btho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Btheta7330_00449
Enzymes [BR:btho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.130  glycoprotein endo-alpha-1,2-mannosidase
     Btheta7330_00449
    3.2.1.198  alpha-mannan endo-1,2-alpha-mannanase
     Btheta7330_00449
SSDB
Motif
Pfam: Glyco_hydro_99 Glyco_tran_WbsX
Other DBs
NCBI-ProteinID: ALJ40035
UniProt: A0A0N7I9G6
Position
609682..610830
AA seq 382 aa
MRKELVFVLLALFLCAGCNGNKKKMNGEHDLDAANITLDDHTISFYYNWYGNPSVDGEMK
HWMHPIAPAPGHSGDAGAISGLNDDIACNFYPDLGTYSSNDPEIIRKHIRMHIKANVGVL
SVTWWGESDYGNQSVSLLLDEAAKVGAKVCFHIEPFNGRSPQTVRENIQYIVDTYGDHPA
FYRTHGKPLFFIYDSYLIKPAEWAKLFAAGGEISVRNTKYDGLFIGLTLKESELPDIETA
CMDGFYTYFAATGFTNASTPANWKSMQQWAKAHNKLFIPSVGPGYIDTRIRPWNGSTTRD
RENGKYYDDMYKAAIESGASYISITSFNEWHEGTQIEPAVSKKCDAFEYLDYKPLADDYY
LIRTAYWVDEFRKARSASEDVQ
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaggaaagaacttgtttttgttttattggcattatttctgtgtgccggctgtaacggc
aacaaaaagaaaatgaacggtgaacacgatttggatgcggcaaacattacgttggatgac
catacgattagtttttattataactggtatggaaatccgtcagtggatggagaaatgaag
cactggatgcacccgatagctcctgctccggggcattcgggagatgccggtgccatatcc
ggacttaatgatgacatcgcctgtaatttttatccggacctcgggacgtacagcagcaat
gatcctgaaatcattcggaaacatatccggatgcatataaaagcgaatgtcggcgtactg
tctgtcacttggtggggagaaagcgattatggcaaccaaagtgtgtctctcctgctggat
gaggctgccaaagtaggggcaaaggtgtgctttcatatagagccttttaatggacgcagc
ccgcaaacggtaagggagaatattcaatatatagtggatacttatggtgatcacccggct
ttttaccgtacgcacggcaaacctcttttctttatctatgattcttatctgatcaaacct
gccgagtgggcgaagttgtttgctgccgggggagagataagtgtgcgtaataccaagtac
gacggtctttttattggtctgacattgaaggaaagcgagttgcccgacattgagacagcg
tgcatggatggcttttacacttactttgccgcaacaggtttcacaaatgcttctactccg
gccaactggaaatccatgcagcaatgggcaaaggcacataataaattgtttattccgagt
gtcggtccgggatatattgatacccggattcgtccttggaacggaagtaccacccgagac
cgtgagaatggaaaatattacgatgatatgtataaagctgccatagaaagcggtgcttct
tatatttcgattacgtctttcaatgaatggcatgaaggaactcagatagagccggctgtc
tcaaagaagtgcgatgcttttgaatatttggattataaaccattggctgatgattactat
ttgataagaactgcctattgggtagatgaattccggaaagcaagatctgcttcggaagat
gttcaataa

DBGET integrated database retrieval system