KEGG   Bacillus thuringiensis Al Hakam: BALH_3381
Entry
BALH_3381         CDS       T00429                                 

Definition
(GenBank) UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00541  O-Antigen nucleotide sugar biosynthesis
btl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    BALH_3381
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BALH_3381
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 3Beta_HSD NAD_binding_10 adh_short
Other DBs
NCBI-ProteinID: ABK86618
UniProt: A0RHC5
Position
complement(3580802..3581713)
AA seq 303 aa
MKKNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRAHRESIGNGITCNLTNKSEVIR
VMKQIKPDYVLHLAGRNSVIESWTAALEYVEVNVIGTLYLLEAITQEAPHCRTLVIGSAL
QADCMSNIKILNPYSLSKTMQVIIAEAWSELMNSNIIIAKPTNLIGPGISNGICSILAKK
MIDIESGRSKAVIEVNSLKDSRDFLDVRDAVKAYHVLLRDGISGKQYNIGSGVKRSLLDV
LEQYKELTRLNFFIDETEKSGSESNESLVIEDIRRLGWIPEIQFHQSLKDVLEYVKCSDI
CIQ
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaaaaaaaatgcgagccttttaataactggtgcaaatggtttcacaggacgccatgct
tgccaatattttttagagcagggctttcatgtaattcctatgtttcaaaatcgtgcacat
agagaaagcattgggaatggtattacttgtaatttaactaataagagcgaagtaattagg
gtaatgaaacaaataaagccagattatgtattgcatttagcaggaaggaattcggtcata
gagtcttggacagctgctcttgaatatgtagaggttaatgtaataggaacattatattta
ttagaagcaattacgcaagaagcacctcattgtagaacattggttataggatctgctttg
caagcagattgtatgagcaacataaaaattttaaatccatatagtttaagtaaaacgatg
caagtcattattgcagaggcgtggagtgaattaatgaattcaaatattatcattgcaaag
cccacgaatttaattggtccaggaatatcgaatggcatttgttcaattctcgcaaaaaaa
atgatagatatagaatcaggtagaagtaaagctgttatcgaagtaaacagtttaaaagat
agtagggattttttagatgtacgtgatgcagttaaagcgtatcatgtgttattacgagat
gggataagtggaaaacaatataatattggttcaggagtgaaacgatctttattagatgta
ctagaacaatataaggaattaacacgattgaatttttttatagatgaaacagagaaaagt
gggagcgaatcaaatgagagtttagtaatagaggatataagaaggttagggtggatccca
gaaattcaatttcatcaatcattaaaagatgtacttgagtatgtgaagtgcagtgacatt
tgcattcaatga

DBGET integrated database retrieval system