KEGG   Kyrpidia tusciae: Btus_2703
Entry
Btus_2703         CDS       T01220                                 

Name
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
bts  Kyrpidia tusciae
Brite
KEGG Orthology (KO) [BR:bts00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Btus_2703
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     Btus_2703
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox_dim Pyr_redox DAO HI0933_like NAD_binding_8 FAD_oxidored K_oxygenase Tryp_inh XdhC_C
Other DBs
NCBI-ProteinID: ADG07352
UniProt: D5WUA0
Position
2728843..2730327
AA seq 494 aa
MTKHYDRFQPTICINEDDHREFDAIFIGGGAAGRFGSAYLRAMGGRQLIIEKGDHLGGQC
CKNACVPHHLFFDLTVQLDQLRRFGGTYVWPKLDFKPKLADIIQMYLNGRENLYDFMFEQ
SKEQLGIEFILNHEPRIIDNHTVEVAGRAFKTKNIVLALGSRPNRPDIPGLHLKGVIDHT
SLVEGVLDYEPERMVVIGGGHTMAPYASFFCALGMETTVVNRSPVLKKMDLETKAYVLDM
MRERGVKFYENCPPLAILGEDRVTGVKIRTPEGEKVIPCDTVFLATGMRPNSDYPRQALG
IEVDAKGTVIVDEYLRTNVPNVYAVGDLIGAPMEMFKARRSGMVASRNILGVPTRWQVGM
FAEQFHSFYEVTYLGLTEEKAREMYGDDLMFIRMPPGDRSIALPAAERSITYSFLAPELS
GFQKAIIQKSTRKVLGLHHVGFGAKEGFQYLSWIMQNGELTIDDFAEMNELFLNPSHFIQ
LARLRAGQRELVNL
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgacgaaacactacgatcgttttcagccgactatctgcatcaatgaagacgatcatcga
gaatttgatgcgattttcatcgggggaggcgcggcggggcggtttggatccgcttacctt
cgcgccatgggcgggcgccagctcatcattgaaaaaggagatcatctcggcggacagtgc
tgcaagaacgcctgtgtgccgcaccacctgtttttcgatctgacggtccagttggatcag
ttgcgccgttttggaggaacgtatgtctggccgaagctggactttaagccgaaactggcc
gatatcatccaaatgtatctgaatggacgggaaaatctctatgatttcatgttcgaacag
agcaaggaacaactgggaatcgaattcatcctgaatcatgagccgcggatcatcgacaat
cacaccgtggaggttgccggacgggcgttcaaaacgaagaacattgtcctggccctgggg
tcgaggccgaatcgtccggatattccgggacttcatctgaaaggcgtcatcgaccacacg
tccttggtcgagggagttctggattacgagccggagcggatggtggtcatcggcggcggc
cacaccatggccccctacgcctccttcttctgcgcgctggggatggagaccacagtggtc
aaccgctccccggtgctgaaaaagatggacctggaaaccaaagcgtacgtgttggacatg
atgcgggagcggggcgtgaagttttacgagaattgcccgccgttggcgattctgggcgag
gatcgggtcaccggggtcaagatccggacgcccgaaggcgaaaaagtgattccttgtgac
accgtctttttggccacgggcatgcggcccaattccgattacccgaggcaggccttgggg
attgaagtggatgccaaagggacggtgatcgtcgacgagtacctgaggaccaatgttccc
aacgtctacgcggtgggggatctcatcggcgctccgatggaaatgttcaaagcgcgccga
agcgggatggtcgcatcaaggaacatcttgggcgtgcccacccgctggcaggtggggatg
tttgccgagcagttccattctttctatgaagtcacgtacctggggttgacggaagaaaag
gcgagggagatgtacggggacgacctgatgttcatccggatgccgccaggggatcgatcg
attgcccttccggccgccgagcggtccatcacgtacagcttcttggcgccggagttgtcg
ggattccagaaagcgatcattcagaaaagcacccggaaagtgctggggctgcaccacgtg
gggtttggtgccaaggaggggttccagtatctttcctggatcatgcaaaacggagagttg
acgattgatgactttgcggaaatgaatgaactgtttctcaacccctcgcatttcatccag
ttggcccggctccgggcggggcagcgggaactggtcaacctgtga

DBGET integrated database retrieval system