Bacillus toyonensis: Btoyo_1758 Help Entry Btoyo_1758        CDS       T02901                                  Name (GenBank) Thioredoxin   KO K03671   thioredoxin Organism bty  Bacillus toyonensis Brite KEGG Orthology (KO) [BR:bty00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bty03110]     Btoyo_1758 Chaperones and folding catalysts [BR:bty03110]  Protein folding catalysts   Protein disulfide isomerase    Btoyo_1758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin_9 Redoxin Thioredoxin_3 TraF Thioredoxin_7 Glutaredoxin Glrx-like HyaE OST3_OST6 KaiB AGP Motif Other DBs NCBI-ProteinID:  AHA07760 Position complement(1723027..1723341) Genome browser AA seq 104 aa AA seqDB search MAIINANDQSFAAETSEGVVLLDFWAPWCGPCKMIAPVLEEIDSELGEKVKVVKVDVDEN QETARQFEVMSIPALFVLKDGKVVDQALGYKPKEALVELVSKHF NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaattataaacgcaaatgaccaaagcttcgcagctgaaactagcgaaggtgttgta ttattagatttctgggcaccttggtgtggaccttgtaaaatgatcgctcctgtattagag gaaatcgattcagaattaggtgaaaaagtaaaagtagtaaaagtagacgttgatgaaaac caagaaactgctcgtcaatttgaagtaatgagcattccagctcttttcgtattaaaagac ggtaaagtagttgatcaagcgttaggttacaaaccgaaagaagcgttagtagaattagtt tctaaacacttctaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (15) Pfam (15) All databases (17) Download RDF

DBGET integrated database retrieval system