KEGG   Burkholderia sp. RPE67: BRPE67_BCDS00600
Entry
BRPE67_BCDS00600  CDS       T03604                                 

Definition
(GenBank) benzoquinone reductase
  KO
K23529  2-hydroxy-1,4-benzoquinone reductase [EC:1.6.5.7]
Organism
bue  Burkholderia sp. RPE67
Pathway
bue00361  Chlorocyclohexane and chlorobenzene degradation
bue00627  Aminobenzoate degradation
bue01100  Metabolic pathways
bue01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bue00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BRPE67_BCDS00600
   00361 Chlorocyclohexane and chlorobenzene degradation
    BRPE67_BCDS00600
Enzymes [BR:bue01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.7  2-hydroxy-1,4-benzoquinone reductase
     BRPE67_BCDS00600
SSDB
Motif
Pfam: FMN_red Flavodoxin_2
Other DBs
NCBI-ProteinID: BAO87974
UniProt: A0A7U6JL32
Position
2:62014..62565
AA seq 183 aa
MALKIAVVVGSLRRDSFNKQLAHALASLAPSDFSFDFVDIGGLPLYSQDYDSDFPEVARA
FKQQIADADGLLIVTPEYNRSMPGVLKNALDWASRPWGQSVWGGKPGAIIGTSVGAIGTA
IAQSHLRGVCAYLDIVLMNQPEMYIKHDESRIDANGNIVSEDTRKYLQTFMDKYAAWVRD
RAV
NT seq 552 nt   +upstreamnt  +downstreamnt
atggccttgaagatcgcggtggtcgttggaagcctgcggcgggattcgttcaacaagcaa
ctcgcgcacgcgcttgcatcgctcgcgccgagtgatttttccttcgacttcgtcgatatc
ggcggcctgccgctgtacagccaggactacgacagcgactttcccgaagtcgcgcgcgca
ttcaagcaacagatcgccgatgccgacggcctgctgatcgtcacgcccgaatacaaccgc
tcgatgcccggcgtgctgaagaacgcgctcgactgggcctcgcgtccgtgggggcagagc
gtgtggggcggcaagccgggcgcgatcatcggcacgtcggtcggggcgatcggcacggcc
atcgcgcaatcgcatctgcgcggcgtgtgcgcgtatctcgatatcgtgctgatgaatcag
ccggagatgtacatcaagcacgacgaaagccgcatcgacgcgaacgggaacatcgtgagc
gaggacacgcgcaagtacctgcagacgttcatggacaagtacgccgcatgggtgcgcgac
cgcgcggtgtaa

DBGET integrated database retrieval system