KEGG   Burkholderia sp. HB1: AC233_11145
Entry
AC233_11145       CDS       T04094                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
buq  Burkholderia sp. HB1
Pathway
buq00626  Naphthalene degradation
buq01100  Metabolic pathways
buq01120  Microbial metabolism in diverse environments
buq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:buq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    AC233_11145
Enzymes [BR:buq01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     AC233_11145
SSDB
Motif
Pfam: DSBA DUF2530
Other DBs
NCBI-ProteinID: ALE55178
Position
1:complement(2584808..2585398)
AA seq 196 aa
MTKNLDFYFDFISPFSYLAHIKLPELARQYGYTITYHPIDIPTAKIAAGNYGPSNREVQS
KMKVLLADMHRWAARYDVPLTFPKGFKGERWNIGVLYADKKRDTEAYVTEAYHRIWGLGI
NPSDEGQLGEVAEKMGWNVAEFVAFVSSPEGQTAFRKSCVEAHAIGVFGAPIMMVGEEVW
WGNDRLMFLEDFMRSH
NT seq 591 nt   +upstreamnt  +downstreamnt
atgacgaaaaacttggatttttattttgatttcatcagcccgttcagctatttagcacat
atcaagctgccggagctggcgaggcaatatggatacacaatcacctatcatccgatagac
ataccgacagcaaagatagcggccgggaactacggtccctcaaaccgcgaggtgcagtcg
aagatgaaggtgctactggcggacatgcatcggtgggcggcgagatatgacgtgcctttg
acgtttcccaaaggtttcaaaggtgagcgctggaatatcggcgtgctgtacgcggacaag
aagcgcgatacagaagcgtacgtcaccgaagcctaccatcgaatttggggactcggcatc
aatccctctgacgaaggtcaactaggtgaggtggcggaaaagatgggttggaatgtagcg
gagtttgtggcgtttgtctcttccccagaagggcagacggcatttcgcaagagctgcgtc
gaagcgcatgctataggtgttttcggcgcgcccataatgatggtcggcgaagaggtctgg
tggggaaacgaccgcttgatgtttcttgaagacttcatgcgtagccattaa

DBGET integrated database retrieval system