Burkholderia sp. JP2-270: DM992_20390 Help Entry DM992_20390       CDS       T07766                                  Name (GenBank) NUDIX hydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism burk  Burkholderia sp. JP2-270 Brite KEGG Orthology (KO) [BR:burk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:burk03400]     DM992_20390 Enzymes [BR:burk01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      DM992_20390 DNA repair and recombination proteins [BR:burk03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     DM992_20390  Prokaryotic type     DM992_20390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 NUDIX_2 Nudt16-like Motif Other DBs NCBI-ProteinID:  AWV01869 UniProt:  A0A2U9SWW9 Position 2:600091..600495 Genome browser AA seq 134 aa AA seqDB search MSSPQPTEVPVKERATIVCYRDGQVLLVARASSRWALPGGTIKRGEPPLEAAHRELREET GMTGQTLVYSMQFTGLAKAHHVFFTEVGPDQTPQANNEIEKCRWFPVDGVDELRASIPTK RIVELVYNHEIRKS NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagttctccccaaccgaccgaagtacccgttaaagaacgggcgacgatcgtctgctat cgcgacggccaagtgttgctcgtcgcgcgcgcgtcgtcgcgctgggcccttccgggcggc acgatcaagcgcggggaaccgccgctcgaagccgcgcatcgcgagttgcgcgaagaaacc ggcatgaccggccagactctcgtttactcgatgcaattcaccgggctcgcgaaggcacat cacgtgttcttcacggaagtcggcccggaccagacgccgcaagcgaacaacgagatcgag aaatgcaggtggtttccggtcgacggcgtcgacgaactgcgcgcgagcatcccgacgaag cgaatcgtcgaactcgtctataaccacgaaatccgcaagtcgtag

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system