KEGG   Bacillus mycoides WSBC 10204: bwei_1210
Entry
bwei_1210         CDS       T03453                                 

Definition
(GenBank) UDP-2-acetamido-2,6-dideoxy-hexulose 4-reductase
  KO
K24311  UDP-4-keto-6-deoxy-GlcNAc-4-reductase [EC:1.1.1.-]
Organism
bww  Bacillus mycoides WSBC 10204
Pathway
bww00541  O-Antigen nucleotide sugar biosynthesis
bww01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bww00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    bwei_1210
Enzymes [BR:bww01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     bwei_1210
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_10 adh_short Synapsin
Other DBs
NCBI-ProteinID: AIW83868
UniProt: A0A0A0WI42
Position
1106588..1107496
AA seq 302 aa
MKRNASLLITGANGFTGRHACQYFLEQGFHVIPMFQNRSHREKIENGITCDLTNKSEVMK
VIKQIKPDYVLHLAGRNSVNESWTASLEYIEINVIGTLYLLEAIKQEASHCKTLVIGSAL
QADSMKNIKVSNPYSLSKTMQVIIAEAWGGLMDSNIIIAKPSNLIGPGVSNGVCSILAKK
MIDIESGRSKAIIEVNSLKDSRDFLDVRDAVKAYHVLLRDGINGKQYNIGSGVKRSLLDV
LEQYKGLTQLNFTIKETENSESGSNESLVLEDIKKLGWVPEIPFQQSLKDVLEYAKCSDV
CI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaagaaatgcgagccttttaataactggtgcaaatggcttcacaggacgtcatgct
tgccaatattttttagagcagggctttcatgtaattcctatgtttcaaaatcgttcacat
agagaaaaaatcgaaaatggtattacttgtgatttaacaaataagagtgaagtaatgaag
gtaattaaacaaataaaaccagactatgtattgcatttagcaggaagaaactcagttaat
gagtcttggacagcttctctggaatatatagagattaacgtaatagggactttatattta
ttagaagccattaagcaggaagcctcgcattgtaaaacattagttataggatctgcattg
caagcagatagtatgaaaaacataaaagtttcaaatccatatagtttaagtaaaactatg
caagtcattattgcggaggcttggggcggattaatggattcaaatattatcattgcaaag
ccctcaaatttaattggtccaggagtatcgaatggtgtttgttcaattctcgcaaaaaaa
atgatagatatagaatcgggtagaagtaaagcgattattgaagtaaacagtttgaaagat
agtagagactttctagatgtacgtgatgcagttaaagcgtatcatgtgttattacgtgat
ggtataaatggaaaacaatataatattggatcaggagtaaaacgctctttattagatgta
ttggaacaatataaaggattaacacagttgaattttactataaaagaaacagagaatagt
gagagcggctcaaatgaaagtttagtattagaggatataaaaaagttaggttgggttcca
gaaatcccatttcagcaatcattaaaagatgtacttgagtatgcgaagtgtagtgacgtc
tgcatttaa

DBGET integrated database retrieval system