KEGG   Bacteroides xylanisolvens: BXY_34140
Entry
BXY_34140         CDS       T02579                                 
Name
(GenBank) Glycosyl hydrolase family 71.
  KO
K21132  alpha-mannan endo-1,2-alpha-mannanase / glycoprotein endo-alpha-1,2-mannosidase [EC:3.2.1.198 3.2.1.130]
Organism
bxy  Bacteroides xylanisolvens
Brite
KEGG Orthology (KO) [BR:bxy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BXY_34140
Enzymes [BR:bxy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.130  glycoprotein endo-alpha-1,2-mannosidase
     BXY_34140
    3.2.1.198  alpha-mannan endo-1,2-alpha-mannanase
     BXY_34140
SSDB
Motif
Pfam: Glyco_hydro_99 Glyco_tran_WbsX Glyco_hydro_71
Other DBs
NCBI-ProteinID: CBK68409
UniProt: D6D1V7
Structure
Position
4289061..4290203
AA seq 380 aa
MMIFFLSLSLESCSKEDDNNPSNSENNGGNNNLGTELDYDTFCFYYDWYGSEAIDGQYRH
WAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGV
LALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNH
PAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPF
ILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGS
VIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENRE
PDYYLTRTAYWVGKFRESKQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgatttttttcttgtcactttcattggaaagttgtagcaaagaagatgataataat
ccttctaattcggagaataacggaggaaataataatttaggtacagagttggattatgat
actttctgcttttattatgattggtatggaagtgaggctattgacggtcaatatagacat
tgggcccatgctatagcacccgatcctaatggtggatccggtcagaatccggggaccatt
ccgggtacacaggagagtatagccagtaatttttatcctcaattaggaagatatagtagt
agtgatcctaatattttgaccaaacatatggatatgtttgttatggcgcgtaccggagtg
ctggcacttacctggtggaatgaacaggatgagactgaagccaagagaatcggtcttata
ctggatgcagcagataagaaaaaaataaaagtatgttttcacttggagccatatcccagc
agaaatgtgcagaatctccgggagaacatagttaaattgataacgaggtatggaaatcac
ccggccttctacagaaaggatggcaaacctttgttttttatttatgactcttatttaatc
gaacctagtgaatgggaaaagttattaagtcctggtggttccattacaatcagaaataca
gcctatgatgctttgatgattggattatggacttctagtccgacagtgcaacggcctttt
attttgaatgctcattttgatggtttctatacatattttgcagctaccgggttcacgtat
ggttctaccccgactaattgggtaagtatgcaaaaatgggcaaaggaaaatggtaagata
tttattccaagtgtgggtcccggatatatagacacacgtatacgtccttggaatggttcg
gtaatccggactagaacggatgggcagtattatgacgctatgtatcgaaaggccattgaa
gctggggtttcggctatttctattacctcctttaatgaatggcatgaagggagccagata
gaaccggctgtgccttacacaagttccgagtttacttatttggattatgagaaccgtgaa
cctgattattatctcacccgcactgcgtactgggttgggaaatttagagaaagcaaacag
taa

DBGET integrated database retrieval system