KEGG   Burkholderia sp. YI23: BYI23_E003880
Entry
BYI23_E003880     CDS       T01711                                 

Definition
(GenBank) para-benzoquinone reductase
  KO
K23528  p-benzoquinone reductase (NADPH) [EC:1.6.5.6]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00627  Aminobenzoate degradation
byi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BYI23_E003880
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.6  p-benzoquinone reductase (NADPH)
     BYI23_E003880
SSDB
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_5 Flavodoxin_1
Other DBs
NCBI-ProteinID: AET95549
UniProt: A0A7U4AR92
Position
byi_2p:complement(352705..353331)
AA seq 208 aa
MATKIQIVFYSGYGHIYKMAEAIAAGVREVDGVEVKLLQVPELVPEEVLVKSGMKGYRAA
FESVAVATPEMLAEADGIIFGTPTRFGNMCAQMRNFLDQTGGLWMNGGLIGKVGSVFTST
ASQHGGQETTISSFHTTLLHHGMVIVGVPYSEQRLVNMSEVSGGTPYGASTLAGADGSRQ
PSENELAIARFQGQHVATITKKLVAQSK
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcaactaagattcagattgtgttctacagcggctacggccacatctacaagatggcc
gaggcaatcgcggcaggcgtccgagaagttgacggcgttgaagtgaagttgctccaagtt
ccggaactcgtacccgaagaagtcctggtcaagagcggcatgaagggctatcgcgctgca
ttcgagagcgttgcggtcgcaacgccggaaatgctcgcggaagcagacggcatcatcttc
ggcacgccgactcgattcggcaacatgtgtgcgcagatgcgtaacttcctggaccaaacg
ggtggtctgtggatgaacggtggcctgatcggcaaggtcggtagcgtcttcacgagcacg
gcttcgcagcacggcggtcaagaaacgactattagcagcttccacacgacccttctgcat
cacggcatggtcatcgtcggcgttccgtactcggagcagcgcctggtcaacatgagcgaa
gtttccggtggcacgccttacggcgcctcgacgctcgcaggtgcggacggttcgcgtcag
ccgagcgagaacgagcttgcaatcgctcgtttccagggccagcacgtcgccacgatcacc
aagaagctggttgcacagtcgaagtaa

DBGET integrated database retrieval system