Corynebacterium accolens: CACC_00775 Help Entry CACC_00775        CDS       T08449                                  Symbol mutT1 Name (GenBank) 8-oxo-dGTP diphosphatase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism cacc  Corynebacterium accolens Brite KEGG Orthology (KO) [BR:cacc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cacc03400]     CACC_00775 (mutT1) Enzymes [BR:cacc01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      CACC_00775 (mutT1) DNA repair and recombination proteins [BR:cacc03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     CACC_00775 (mutT1)  Prokaryotic type     CACC_00775 (mutT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_2 NUDIX_4 Motif Other DBs NCBI-ProteinID:  UQZ26896 Position complement(154632..155021) Genome browser AA seq 129 aa AA seqDB search MIGAMIEVAAIVFRNSFGHVLGVRKASSTKFQLPGGKLEEGESPVQAAAREAEEEIGVQV RLPELTELGTFSAPAANEPGQTVRGHIFTYPRPVIAHAAAEIAETAWIDPAAPQCELADL LRSEVFPAL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgatcggggccatgattgaagtcgcagccatcgttttccgcaattcctttggccacgtg cttggcgtacgcaaggcctcatccacgaagttccagctgccgggcggcaagctagaagaa ggagaaagcccagtccaggccgctgcgcgcgaggcggaagaagaaatcggcgtgcaggta cgcctacctgaacttaccgagctcggcaccttcagcgcccccgccgccaatgagccaggc cagaccgtccgcgggcatatctttacctacccgcgccccgtcatcgcccacgccgcggcc gaaatcgcagaaaccgcctggatcgatcccgccgccccgcagtgcgagcttgctgatctc ctgcgcagcgaggtttttccggcgctgtaa

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system