KEGG   Catenulispora acidiphila: Caci_0990
Entry
Caci_0990         CDS       T00967                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cai  Catenulispora acidiphila
Pathway
cai00473  D-Alanine metabolism
cai01100  Metabolic pathways
cai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caci_0990
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Caci_0990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
    Caci_0990
Enzymes [BR:cai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Caci_0990
Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
 Precursor biosynthesis
  Racemase
   Caci_0990
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Other DBs
NCBI-ProteinID: ACU69918
UniProt: C7Q458
Position
1129987..1131180
AA seq 397 aa
MTDLTATDFPPGATLRAEARIDLDAIRSNTRRLGQIVAETGSKSAAGVMAVVKADAYGHG
AVPCARAAKQGGAAWLGTALPEEALQLRAAGLTGPILAWLHPAGGPWDELIVHEIDVTAY
APWVLEEITAAAQRCGIQARVQLKVDTGLGRGGTQPHDWLELVELAAKAEAAGHIRVTGV
WSHFACADEPGHPSIRAQLDVFALALAAADHAGLRPEVRHIANSPAALSLPEAHFDLVRA
GLAVYGLSPLPDTTPADFGLRPAMTLTARVALVKNAPAEHGVSYGHIHHTAGPTTLALVP
LGYADGLPRNSSNVGEVLVGGARHRVAGRMAMDQFVVDLGDPDAVHDVHVGDEVVIFGPG
DRGEPTADDWAQATGTLNYEIVTRIGPRVPRVYVGNS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgacagacctgaccgccaccgattttccgcccggcgccacgttgcgtgccgaggcgcgg
atcgacctggacgcgatccgctccaacacccggcgattaggccagatcgtcgccgagact
ggttctaagagcgccgccggggtgatggcggtggtgaaggcggacgcctacggccacggc
gccgtgccgtgcgcgcgcgccgccaagcagggcggcgccgcctggctcggcaccgccttg
ccggaggaggcgctgcagctgcgcgccgccggcctgaccggtccgatcctggcctggctg
cacccggccggcgggccctgggacgagctgatcgtccacgagatcgacgtcaccgcctac
gccccctgggtcctggaggagatcaccgccgccgcgcagcgctgcggtatccaggcgcgc
gtgcagctcaaggtcgacaccggcctcgggcgcggcggcacccagccgcacgactggctg
gagctggtcgagctggccgccaaggccgaggccgccgggcacatccgggtcaccggcgtg
tggtcgcacttcgcctgcgccgacgagcccggccacccctccatccgggcccagctggac
gtcttcgccctggcgctggccgccgccgaccacgcgggcctgcgccccgaggtccgccac
atcgccaacagcccggccgccctgagcctgcccgaggcgcacttcgacctggtccgcgcg
ggcctggcggtctatggcctctcgcccctgccggacaccacccccgccgacttcggcctg
cgcccggcgatgacgctgacggcgcgcgtcgcgctggtcaagaacgccccggccgagcac
ggcgtgtcctacggccacatccaccacaccgccgggcccacgaccctggcgctggtcccg
ctcggctacgccgacggcctgccccgtaactcctccaacgtcggcgaggtcctggtcggc
ggcgcgcggcaccgggtcgccgggcgcatggcgatggaccagttcgtcgtcgatctcggc
gacccggatgccgtccacgacgtgcacgtcggcgacgaggtagtgatcttcggaccaggc
gaccgcggcgagccgacggccgatgattgggcccaggcgaccgggacattgaattacgag
atcgtcacgcgcatcggtccgcgtgtcccgagggtctacgtcgggaactcgtga

DBGET integrated database retrieval system