KEGG   Catenulispora acidiphila: Caci_3434
Entry
Caci_3434         CDS       T00967                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
cai  Catenulispora acidiphila
Pathway
cai00473  D-Alanine metabolism
cai01100  Metabolic pathways
cai01503  Cationic antimicrobial peptide (CAMP) resistance
cai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caci_3434
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Caci_3434
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Caci_3434
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cai01504]
    Caci_3434
Enzymes [BR:cai01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     Caci_3434
Antimicrobial resistance genes [BR:cai01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    Caci_3434
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: ACU72340
UniProt: C7Q920
Position
complement(3802174..3803733)
AA seq 519 aa
MTRTPITPLHLAISRIAAEHPDAPAVLGLDGTVLSYARLDRAADAWARELRRRGVRAGDL
VPVLMTRSPELPPALLAILKCGAAYAALDHRWPDARIADVLAKLGTSPVVVGPDHREAAE
RLGLDVWCPPPLAGAGAADSDDQATVGLEHTDAGATACVFFTSGTTGESKGVLSPHSATM
RLFDPTGTMAFTPGCVTPLSTYLTWDVAAFELWGVLTSGGTCVPVADDFLTPHSVTELIE
VQGVNTLWLTTSLFHLLVDEDIDCFTGLHRLYVGGERMSPEHARAFLRRHPDIEFYNCYG
PVEVCMVVTTHRVTLADCDDERGIPLGRVVPYTEILVMDGDRRCEPGEPGEMCMAGAGVA
RGYLADDALTKAKFTEVQDGDRSVRVYRGGDMGTVDEQGRHFFLGRTDRQIKLRGHRVEL
DGIEAEVHAAAPGTACAVVALTGASGGYEHLALFYARPPDAVDHGPDPLHLRATLATRLP
GYSVPDTVVALDRLPLNVNGKIDRATLISEHWGSRQLQL
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgaccaggacaccgatcacccccctccacctcgcgatctcccggatcgccgccgagcac
ccggacgccccggccgtgctgggcctggacgggaccgtgctgagctacgcgcggctggac
cgcgccgccgacgcctgggcgcgcgagctgcgccgccggggcgtgcgcgccggggacctc
gtcccggtgctgatgacccgctcccccgaactgccgccggcgctgctggcgatcctgaag
tgcggcgccgcctacgccgcgctggaccaccgctggccggacgcgcggatcgccgacgtg
ctggcgaagctgggcacgtcgccggtggtggtcggcccggaccatcgggaggcggccgag
cggctggggttggatgtgtggtgtccgccgccgttggcgggcgcgggagccgcggactct
gacgatcaggccaccgtcgggctcgaacacaccgacgccggcgcgaccgcctgtgtcttc
ttcacctcgggcacgaccggcgagtccaagggagtcctgtcgccgcacagcgcgaccatg
cggctgttcgatccgacgggcacgatggcgttcacgccgggctgcgtcacgccgctgtcg
acgtatctgacctgggatgtcgccgcgttcgagctctggggcgtgctcacttcgggcggc
acgtgcgtcccggtcgccgacgacttcctcactccgcactcggtgacggagctgatcgag
gtccaaggtgtcaataccctgtggctcacgacctccctgttccatctgctggtcgacgag
gacatcgactgcttcaccgggctgcaccgtctctacgtcgggggcgagcggatgtcgccg
gagcacgcgcgcgccttcctgcgccgccaccccgacatcgagttctacaactgctacggc
ccggtcgaggtgtgcatggtggtcaccacgcaccgcgtcacgctcgccgactgcgacgac
gagcggggcatcccgttgggccgggtcgtcccgtacaccgagatcctcgtcatggacggc
gaccggcgctgtgagcccggcgagcccggcgagatgtgcatggccggcgccggagtggcc
cgcggctacctcgccgatgacgcgctgaccaaggcgaagttcaccgaggtccaggacggg
gaccggagcgtccgcgtctatcgcggcggcgacatgggcacggtcgacgaacaaggacgg
catttcttcctggggcgcaccgaccgtcagatcaagctgcgcggacaccgggtcgaactc
gacgggatcgaggccgaggtgcacgccgccgcgcccggcacggcctgtgcggtcgtggcg
ctgaccggggcgtccggcggttacgaacacctggcgctgttctatgcgcggccgccggat
gccgtcgaccacggaccagacccgctccatctgcgcgcgacgctggccactcggctgccg
gggtactccgtcccggacaccgtggtcgcgctggaccggttgccgttgaacgtcaacggc
aagatcgatcgcgcgaccctgatatcagagcattgggggtcgcggcagttgcagctttga

DBGET integrated database retrieval system