KEGG   Catenulispora acidiphila: Caci_8041
Entry
Caci_8041         CDS       T00967                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cai  Catenulispora acidiphila
Pathway
cai00473  D-Alanine metabolism
cai00550  Peptidoglycan biosynthesis
cai01100  Metabolic pathways
cai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caci_8041
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Caci_8041
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Caci_8041
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
    Caci_8041
Enzymes [BR:cai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Caci_8041
Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
 Precursor biosynthesis
  Amino acid ligase
   Caci_8041
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATP-grasp_3
Other DBs
NCBI-ProteinID: ACU76864
UniProt: C7QH14
Position
complement(9333257..9334441)
AA seq 394 aa
MVSPMSDQKRIRVAVVFGGRSSEHAISCVTAGSVLDALRNGPEPQRYEIVPIGIASDGRW
VLADLPDGGDLNLAITDGRLPEIGLPASAERANLVTMAGDPTARELTVHEPGAVPKSLGE
VDVVLPLLHGPYGEDGTLQGLLELAGVPYVGSGVLASAVSMDKEFMKRLLAQAGFEVGPY
EVVRPRDWGTEEGRAAVRLAVEELGYPVFVKPARAGSSMGITKVDAPEELDQAIDAARRH
DPKVLVEAAIEGREIECGVLEGAGPQDPAEASLPAELRVTGPHAFYDFQAKYLDGSTEVD
IPARLSAEEIEDIRGQAVGVFETLGCEGLARVDFFYQESADGGPGRFIVNEINTMPGFTP
TSMFPQMWQAAGLSYPELIARLIDTALLRPAGLR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtcagtcccatgagcgatcagaagcggatccgggtggccgtcgtgttcggcggacgc
tccagtgagcacgccatctcctgtgtcaccgccggttccgtgctggacgccctgcgcaac
gggcccgagccgcagcgctacgagatcgtgccgatcggcatcgcctccgacggccgctgg
gtgctcgccgacctgcccgacggcggcgatctgaacctcgccatcaccgacggccggctg
ccggagatcgggctgcccgcctccgccgagcgcgcgaacctggtcaccatggccggcgac
ccgaccgcccgcgagctgaccgtgcacgagccgggcgcggtgcccaagtcgctcggcgag
gtggacgtcgtgctgccgctgctgcacggtccctacggcgaggacggcacgctgcagggt
ctgctggagctcgccggcgtcccctacgtcggctccggcgtccttgcctccgcggtctcc
atggacaaggagttcatgaagcggctgctggcccaggccgggttcgaggtcggcccgtac
gaggtcgtgcgcccccgggactggggcaccgaggagggccgggccgcggtgcggctggcc
gtggaagagctcggatacccggtgttcgtcaagccggcgcgggccggctcctcgatgggc
atcaccaaggtggacgcgcccgaggagttggaccaggcgatcgacgccgcccgccgccac
gacccgaaggtcttggtggaggccgcgatcgagggccgggagatcgagtgcggggtgctg
gagggcgccggtccgcaggatccggccgaagcctcgctgcccgccgagctgcgggtcacc
ggaccgcacgcgttctacgacttccaggccaagtacctcgacggcagcaccgaggtggac
atcccggcgcggctgagcgccgaggagatcgaggacatccgcggccaggcggtcggcgtc
ttcgagacgctgggctgcgagggtctggcgcgcgtcgacttcttctaccaggagtcggcc
gacggcggtccggggcggttcatcgtcaacgagatcaacaccatgccgggcttcacgccg
acctcgatgttcccgcagatgtggcaggccgccgggctgtcctacccggagctgatcgcc
cggctgatcgacaccgcgctgctgcggcccgccgggctgcgctga

KEGG   Catenulispora acidiphila: Caci_9048
Entry
Caci_9048         CDS       T00967                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cai  Catenulispora acidiphila
Pathway
cai00473  D-Alanine metabolism
cai00550  Peptidoglycan biosynthesis
cai01100  Metabolic pathways
cai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Caci_9048
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Caci_9048
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Caci_9048
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
    Caci_9048
Enzymes [BR:cai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Caci_9048
Peptidoglycan biosynthesis and degradation proteins [BR:cai01011]
 Precursor biosynthesis
  Amino acid ligase
   Caci_9048
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST TTL ATPgrasp_YheCD RimK
Other DBs
NCBI-ProteinID: ACU77861
UniProt: C7Q5Q0
Position
10460685..10461632
AA seq 315 aa
MSDLGRVVVLAGGLSHERDVSIRSGRRVADALRSAGVEVQVRDIDAALLPSLLADRPDAV
FPTLHGATGEDGAVQGILALLGVPYVGSSAAACRRAFDKPSAKDAIRTAGLATPDWVAIP
KTTFRDLGTHAVLDAVSAALPMPLFVKPARGGSSLGAAAVHTREDLPSAMVACFAYDETA
LIERHITGREIAVSVVDTGTGPQALPAVEIVADSGVYDYAARYTAGITEFFAPARLTAEE
AKSVEQLAVRAHTTLDLSCVSRTDLILDADGIPWFLEVNVAPGLTETSLLPLAAGAADLD
LGVLYRDLVQAVIAE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgagcgacctgggccgtgtcgtcgtcttggccggcggcctcagccatgagcgcgacgtc
tcgatccgttccgggcgccgcgtggccgacgcgctgcgcagtgcgggggtcgaggtacag
gtccgcgacatcgacgccgcgctcctgccgtcgctgctcgccgaccgccccgatgcggtg
ttccccacccttcacggcgccaccggtgaagacggtgcggtgcagggaatcctggcgctg
ctgggtgtcccctacgtcggctcgtcggcagccgcctgccgccgcgccttcgacaagcct
tcggccaaggacgcgatccgcacggccggactcgcaactcccgactgggtcgcgatcccc
aagacgacgttccgagacctcggcacgcacgcagtcctggatgccgtgtccgccgcgctg
ccgatgccgctgttcgtgaagcccgctcgcggcggctcctctctcggcgccgccgccgtg
cacacccgcgaggacctgccctccgcgatggtcgcctgcttcgcctacgacgagacggca
ctcatcgagcggcacatcaccgggcgcgagatcgccgtctcggtcgtcgacaccggcaca
ggtccgcaggcactgcccgccgtcgaaatcgtcgcggactccggcgtctacgactacgcc
gcccgctacaccgcaggcatcaccgagttcttcgccccagcccggctcaccgccgaggag
gcgaagtcggtcgagcagctggctgtgcgcgcccacaccaccctcgacttgtcctgcgtg
tcccgcaccgacctgatcctcgacgccgacggcatcccctggttcctggaagtgaacgtg
gcaccgggtctcaccgagaccagcctgctcccgctcgccgccggtgcggccgacctcgac
ctcggcgtgctctaccgcgatctggtccaggcggtcatcgccgagtag

DBGET integrated database retrieval system