KEGG   Catenulispora acidiphila: Caci_9046
Entry
Caci_9046         CDS       T00967                                 

Definition
(GenBank) hypothetical protein
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
cai  Catenulispora acidiphila
Brite
KEGG Orthology (KO) [BR:cai00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cai03009]
    Caci_9046
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:cai01504]
    Caci_9046
Enzymes [BR:cai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     Caci_9046
Ribosome biogenesis [BR:cai03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    Caci_9046
Antimicrobial resistance genes [BR:cai01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    Caci_9046
SSDB
Motif
Pfam: Methyltransf_4
Other DBs
NCBI-ProteinID: ACU77859
UniProt: C7Q5P8
Structure
PDB: 
4X1O 5BW4 5BW5 5D1N 5D1H

Position
10458094..10458846
AA seq 250 aa
MTRTTALKVLAGKKLTDLDPDEWAKAQASAERILVDVGTGDARTAYRQAIAHPEWLVVGV
DPAWQRMTETAVRAARKPAKGGAPNLVLVSSAIETVPAALHGVADEVMVLMPWGKLLRGV
VLGEADVLSGLRAVAKPGAPLEISIGTSIWREPIPLEIRDLPELTPETVVSTGLTDRLAA
LGWQVADVRLVPHTDLDTISSSWARRLGSGATETVLHLRAVAVDPRDPVGTQHPAAESAQ
DTPEEPQRDV
NT seq 753 nt   +upstreamnt  +downstreamnt
atgactcgcaccaccgccctcaaagtcctcgccggcaagaagctcaccgacctggatccc
gacgagtgggccaaggcccaggcttcggccgagcggattctcgtggacgtcggcaccggc
gacgcgcgcacggcctaccgccaggccatcgcgcatccggagtggctcgtggtcggcgtc
gacccggcgtggcagcgcatgaccgagaccgcggtgcgcgcggcgcgcaagccggccaag
ggcggagctccgaatctggtcctggtcagctcggcgatcgagacggttccggccgccttg
cacggcgtcgccgacgaggtgatggtgctcatgccgtggggcaagctgctgcgcggagtg
gtgctcggtgaagccgacgtcctgtccggtctgcgcgcggtcgccaagcccggcgccccg
ctggagatctcgattggcaccagcatctggcgcgagccgatcccgctggagatccgcgac
ctccccgagctcaccccggagacggtcgtctcaaccggtctgaccgatcgtctggccgcg
ctcggctggcaggtcgccgacgtccggctggtgccgcacaccgatctggacaccatcagc
tcgtcgtgggcgcggcggctgggatcgggcgccacggagaccgttctgcacctccgagcg
gtcgcggtcgacccacgtgacccggtggggacgcagcaccccgccgccgaatccgcccag
gacacccccgaggaaccacagcgcgacgtgtag

DBGET integrated database retrieval system