KEGG   Cicer arietinum (chickpea): 101505365
Entry
101505365         CDS       T02819                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1-like
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
cam  Cicer arietinum (chickpea)
Brite
KEGG Orthology (KO) [BR:cam00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101505365
Enzymes [BR:cam01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     101505365
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth MOLO1
Other DBs
NCBI-GeneID: 101505365
NCBI-ProteinID: XP_012568126
UniProt: A0A1S3DZ54
Position
Ca1
AA seq 515 aa
MDVIYVKQALILEEAKKVYKKFACGEDPMESLYMIDIIQRLGIEHHFAEEIEKQYLILNN
INPIEFVKSHELYDVALTFRLLRQGGHYVNPDLFDSLMCNKRNLREKYGNDMKGLIAMYE
ASQLSMEGEDILKDIGNFSSELLHTWLSRNQNCNEAIYVANTLQYPLHYGLSRFMDNNNI
FLSGLKANNEWTCLEELANINSNIVRIMNQNEIIEVSKWWKDLGMSKEAKFVMYEPLKWY
MWPMTCFTDPNFSEQRIELTKVISLIYVVDDIFDVHGTLDQLTLFTDAAKRWELAGTEKL
PDFMKNCLSLIYKITNEFAEKVYKKHGLNPIDTLKKSWERFLNSVLKEAHWLNSGYLAKA
DEYLKNGIVSTGVHLVLVHSFFLFDHIIQEQTIAILDHQFPNIIYSVAKILRLSDDLEGA
KSGDQNGLDGSYIDCYINEHQDISSEEAQRHVANMISNEWKRLNQEIINPNPIFPSSFIN
FCLNAARMVPLMYHYGSNSNPSLSNLQQFVKSLIS
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggatgttatctatgtcaaacaagctttgattttggaggaagccaagaaagtatataaa
aaatttgcttgtggtgaggatccaatggagagtttgtatatgattgacatcatccaaagg
cttggaattgaacaccactttgctgaggagattgaaaaacaatatttgatattgaacaac
attaatcccattgagtttgtcaagagccatgaactatatgatgttgcacttacatttcgc
ttgctaagacaaggaggccattatgttaatccagatttatttgacagcttgatgtgtaac
aaaagaaatttaagagaaaaatatggcaatgatatgaagggtctcattgctatgtacgaa
gcatctcaactaagtatggaaggagaagatattctaaaagatatagggaattttagtagt
gagcttcttcatacatggttgtcaagaaatcaaaattgcaatgaagctatttatgttgca
aacactcttcaatatccacttcactatggcttgtcaaggttcatggacaataataacata
ttcctaagtggtttgaaggccaataatgaatggacttgtttagaggagcttgctaatatc
aattccaacatagttagaatcatgaatcaaaatgagatcattgaagtttccaaatggtgg
aaagacctaggaatgtccaaggaggccaagtttgttatgtatgaaccactcaaatggtac
atgtggcccatgacatgctttacagatccaaacttttcagagcaaaggattgaactcacc
aaagttatctctctaatttatgttgttgatgacatttttgatgttcatgggacattagat
caacttactctatttacggacgctgctaaaagatgggaattggctggtacagagaaactt
ccagacttcatgaaaaattgtttaagtttgatttataagattaccaatgaattcgcggaa
aaggtctacaaaaagcatggattaaaccccatagacacgcttaaaaaatcgtgggagaga
tttttaaattctgtgttgaaagaagcacattggttaaattctggttacttggcaaaggca
gatgaatacttgaagaatggaattgttagtacaggagtccatcttgtacttgtgcattca
ttcttcctcttcgatcacattattcaggaacaaactattgctatcttggaccatcaattt
ccaaatatcatatattcagtggctaaaattcttcgtctttctgatgatttagaaggagct
aagagtggagatcaaaatggtcttgatggctcatatattgattgctatattaatgaacac
caagatatttcaagtgaagaagcacaaagacatgttgctaacatgatttcaaatgaatgg
aaacgtctcaatcaagaaatcataaacccaaatccaatatttccatcatcctttatcaat
ttttgtcttaatgctgcaagaatggtccctctcatgtaccattatgggagtaatagtaat
ccaagtctctccaatctacaacaatttgtcaagtcattgatcagttaa

DBGET integrated database retrieval system