KEGG   Cercocebus atys (sooty mangabey): 105584402
Entry
105584402         CDS       T07242                                 

Name
(RefSeq) cytochrome P450 3A8 isoform X1
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty00140  Steroid hormone biosynthesis
caty00591  Linoleic acid metabolism
caty00830  Retinol metabolism
caty00980  Metabolism of xenobiotics by cytochrome P450
caty00982  Drug metabolism - cytochrome P450
caty00983  Drug metabolism - other enzymes
caty01100  Metabolic pathways
caty04976  Bile secretion
caty05204  Chemical carcinogenesis - DNA adducts
caty05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:caty00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    105584402
   00591 Linoleic acid metabolism
    105584402
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    105584402
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105584402
   00982 Drug metabolism - cytochrome P450
    105584402
   00983 Drug metabolism - other enzymes
    105584402
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    105584402
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    105584402
   05207 Chemical carcinogenesis - receptor activation
    105584402
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:caty00199]
    105584402
Enzymes [BR:caty01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     105584402
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     105584402
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     105584402
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     105584402
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     105584402
    1.14.14.-  
     105584402
Cytochrome P450 [BR:caty00199]
 Cytochrome P450, animal type
  CYP3 family
   105584402
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105584402
NCBI-ProteinID: XP_011912545
Ensembl: ENSCATG00000036704
VGNC: 82644
UniProt: A0A2K5MNG2
Position
Unknown
AA seq 503 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNILSYRKGFWQF
DMECYKKYGKMWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFLIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIIYELATHPDVQQKLQEEIDTVLPNKAPPTYDTVLQMEYLDMVV
NETLRIFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWTEPEKFLPERFS
KKNNDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAIIRVLQNFSFKPCKETQIPLKLRLG
ELLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccgggg
cccacacctttgcctttattgggaaatattttgtcctaccgtaagggcttttggcagttt
gatatggaatgttataaaaagtatggaaaaatgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctata
gctgaggatgaagaatggaagagaatacggtcattgctctctccaaccttcaccagtgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttctcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatatatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagaatattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaagctatgct
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaatgacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctataatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccactgaaattacgcttagga
gaacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system