KEGG   Clostridium botulinum A ATCC 19397: CLB_3340
Entry
CLB_3340          CDS       T00574                                 

Symbol
ldhA-2
Name
(GenBank) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00350  Tyrosine metabolism
cba00360  Phenylalanine metabolism
cba00380  Tryptophan metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLB_3340 (ldhA-2)
   00360 Phenylalanine metabolism
    CLB_3340 (ldhA-2)
   00380 Tryptophan metabolism
    CLB_3340 (ldhA-2)
Enzymes [BR:cba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLB_3340 (ldhA-2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-ProteinID: ABS35433
Position
complement(3464927..3465937)
AA seq 336 aa
MGGINYENLSYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDT
CNREALEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALS
LTRKIPFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYD
IFENEEAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARG
ALIDSEALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPH
LGFYTDEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggggggtataaattatgaaaatcttagctattgtgtaagacctgatgaagttgattca
ttcaaaaaattttctgaaaaatatggacatactgttgatttaataccagattcttttggt
cccaatgtggctcatttagcaaaaggatatgatggtatctcaattttaggaaatgatact
tgtaacagagaggcactagaaaagattaaagattgtggtataaaatacttagcaactaga
actgctggagtaaataatatagattttgatgctgcaaaagaatttggcataaatgtagct
aatgttccagcttattctcctaattcagtttcagagtttactataggacttgcattatcc
ctaacaagaaaaatcccttttgcattaaaaagagtagaacttaataattttgcactaggt
ggattaataggggtagaattaagaaacttaactctaggagttataggaactggaagaata
ggtttaaaagtaattgaaggtttttcaggatttggtatgaaaaagatgataggttacgat
atttttgaaaatgaagaagctaaaaaatatattgaatataaatccttagatgaagtattc
aaagaagcagatataataacactacatgcacctttgacagacgataattaccatatgata
ggaaaagaaagtattgctaaaatgaaagatggtgtattcataataaatgcagcacgtgga
gcattaattgatagtgaagctttaatagaagggctaaaatctggtaaaatagctggagca
gccttagattcttatgaatatgaacaaggagttttccataataataaaatgaacgaaatc
atgcaagatgatacattagaaagacttaagagtttcccaaatgtagttattacacctcat
ttaggattctatacagatgaagctgtatcaaatatggttgaaattactcttatgaacttg
caagaatttgaattaaaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system