KEGG   Clostridium botulinum A Hall: CLC_3226
Entry
CLC_3226          CDS       T00575                                 

Symbol
ldhA-2
Name
(RefSeq) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00350  Tyrosine metabolism
cbh00360  Phenylalanine metabolism
cbh00380  Tryptophan metabolism
cbh01100  Metabolic pathways
cbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLC_3226 (ldhA-2)
   00360 Phenylalanine metabolism
    CLC_3226 (ldhA-2)
   00380 Tryptophan metabolism
    CLC_3226 (ldhA-2)
Enzymes [BR:cbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLC_3226 (ldhA-2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-GeneID: 5399042
NCBI-ProteinID: YP_001389008
UniProt: A5I709
Position
complement(3362034..3363029)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
EAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtcccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctagaaaagattaaagattgtggtataaaatacttagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaaaatc
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagttataggaactggaagaataggtttaaaagtaatt
gaaggtttttcaggatttggtatgaaaaagatgataggttacgatatttttgaaaatgaa
gaagctaaaaaatatattgaatataaatccttagatgaagtattcaaagaagcagatata
ataacactacatgcacctttgacagacgataattaccatatgataggaaaagaaagtatt
gctaaaatgaaagatggtgtattcataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaagggctaaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagttttccataataataaaatgaacgaaatcatgcaagatgataca
ttagaaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagctgtatcaaatatggttgaaattactcttatgaacttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system