KEGG   Clostridium botulinum Ba4: CLJ_B3564
Entry
CLJ_B3564         CDS       T00895                                 

Name
(GenBank) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00350  Tyrosine metabolism
cbi00360  Phenylalanine metabolism
cbi00380  Tryptophan metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLJ_B3564
   00360 Phenylalanine metabolism
    CLJ_B3564
   00380 Tryptophan metabolism
    CLJ_B3564
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLJ_B3564
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Other DBs
NCBI-ProteinID: ACQ52350
UniProt: A0A3F2ZU09
Position
complement(3560239..3561234)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGTNVAHLAKGYDGISILGNDTCNREA
LQKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
EAKKYIEYKSLDEVYKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEHEQGVFHNNKMNEIMKDDTLARLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtaccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctacaaaagattaaagattgtggtataaaatacttagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaaaatc
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagtcataggaactggaagaataggtttaaaagtaatt
gaaggtttttcaggctttggtatgaaaaagatgataggttatgatatttttgaaaatgaa
gaagctaagaaatatattgaatataaatccttagatgaagtatacaaagaagcagatata
ataacactacatgcacctttaacagacgataattaccatatgataggaaaagagagtatt
gctaaaatgaaggatggtgtatttataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaaggactaaaatccggtaaaatagctggagcagccttagattcttat
gaacatgaacaaggagttttccataataataaaatgaatgaaatcatgaaagatgataca
ttagcaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagccgtatcaaatatggttgaaattactcttatgaatttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system