KEGG   Clostridium botulinum H04402 065: H04402_03369
Entry
H04402_03369      CDS       T02076                                 

Name
(GenBank) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00350  Tyrosine metabolism
cbj00360  Phenylalanine metabolism
cbj00380  Tryptophan metabolism
cbj01100  Metabolic pathways
cbj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    H04402_03369
   00360 Phenylalanine metabolism
    H04402_03369
   00380 Tryptophan metabolism
    H04402_03369
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     H04402_03369
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-ProteinID: CBZ05169
Position
complement(3502417..3503412)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
EAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtcccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctagaaaagattaaagattgtggtataaaatacttagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaaaatc
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagttataggaactggaagaataggtttaaaagtaatt
gaaggcttttcaggatttggtatgaaaaagatgataggttacgatatttttgaaaatgaa
gaagctaaaaaatatattgaatataaatccttagatgaagtattcaaagaagcagatata
ataacactacatgcacctttgacagacgataattaccatatgataggaaaagaaagtatt
gctaaaatgaaagatggtgtattcataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaagggctaaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagttttccataataataaaatgaacgaaatcatgcaagatgataca
ttagaaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagccgtatcaaatatggttgaaattactcttatgaacttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system