KEGG   Clostridium botulinum A3 Loch Maree: CLK_2700
Entry
CLK_2700          CDS       T00670                                 

Name
(GenBank) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00350  Tyrosine metabolism
cbl00360  Phenylalanine metabolism
cbl00380  Tryptophan metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLK_2700
   00360 Phenylalanine metabolism
    CLK_2700
   00380 Tryptophan metabolism
    CLK_2700
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLK_2700
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-ProteinID: ACA54478
UniProt: B1L1I6
Position
complement(3566678..3567673)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
EAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtcccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctagaaaagattaaagattgtggtataaaatacttagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaagatc
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagttataggaactggaagaataggtttaaaagtaatt
gaaggtttttcaggatttggtatgaaaaagatgataggttacgatatttttgaaaatgaa
gaagctaaaaaatatattgaatataaatccttagatgaggtattcaaagaagcagatata
ataacactacatgcacctttgacagacgataattaccatatgatagggaaagaaagtatt
gctaaaatgaaagatggtgtattcataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaagggctaaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagttttccataataataaaatgaacgaaatcatgcaagatgataca
ttagaaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagccgtatcaaatatggttgaaattactcttatgaatttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system