KEGG   Clostridium botulinum A ATCC 3502: CBO3284
Entry
CBO3284           CDS       T00533                                 

Symbol
fldH
Name
(GenBank) D-phenyllactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00350  Tyrosine metabolism
cbo00360  Phenylalanine metabolism
cbo00380  Tryptophan metabolism
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CBO3284 (fldH)
   00360 Phenylalanine metabolism
    CBO3284 (fldH)
   00380 Tryptophan metabolism
    CBO3284 (fldH)
Enzymes [BR:cbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CBO3284 (fldH)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-ProteinID: CAL84842
UniProt: A5I709
Position
complement(3488938..3489933)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDIFENE
EAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtcccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctagaaaagattaaagattgtggtataaaatacttagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaaaatc
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagttataggaactggaagaataggtttaaaagtaatt
gaaggtttttcaggatttggtatgaaaaagatgataggttacgatatttttgaaaatgaa
gaagctaaaaaatatattgaatataaatccttagatgaagtattcaaagaagcagatata
ataacactacatgcacctttgacagacgataattaccatatgataggaaaagaaagtatt
gctaaaatgaaagatggtgtattcataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaagggctaaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagttttccataataataaaatgaacgaaatcatgcaagatgataca
ttagaaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagctgtatcaaatatggttgaaattactcttatgaacttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system