KEGG   Clostridium botulinum A2: CLM_3717
Entry
CLM_3717          CDS       T00883                                 

Symbol
ldhA
Name
(GenBank) D-lactate dehydrogenase
  KO
K23109  aromatic 2-oxoacid reductase [EC:1.1.1.110]
Organism
cby  Clostridium botulinum A2
Pathway
cby00350  Tyrosine metabolism
cby00360  Phenylalanine metabolism
cby00380  Tryptophan metabolism
cby01100  Metabolic pathways
cby01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cby00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CLM_3717 (ldhA)
   00360 Phenylalanine metabolism
    CLM_3717 (ldhA)
   00380 Tryptophan metabolism
    CLM_3717 (ldhA)
Enzymes [BR:cby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.110  aromatic 2-oxoacid reductase
     CLM_3717 (ldhA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh DpaA_N
Other DBs
NCBI-ProteinID: ACO83491
UniProt: C1FLU1
Position
complement(3730996..3731991)
AA seq 331 aa
MKILAYCVRPDEVDSFKKFSEKYGHTVDLIPDSFGPNVAHLAKGYDGISILGNDTCNREA
LEKIKDCGIKYLATRTAGVNNIDFDAAKEFGINVANVPAYSPNSVSEFTIGLALSLTRKI
PFALKRVELNNFALGGLIGVELRNLTLGVIGTGRIGLKVIEGFSGFGMKKMIGYDLFENE
EAKKYIEYKSLDEVFKEADIITLHAPLTDDNYHMIGKESIAKMKDGVFIINAARGALIDS
EALIEGLKSGKIAGAALDSYEYEQGVFHNNKMNEIMQDDTLERLKSFPNVVITPHLGFYT
DEAVSNMVEITLMNLQEFELKGTCKNQRVCK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaaatcttagcttattgtgtaagacctgatgaagttgattcattcaaaaaattttct
gaaaaatatggacatactgttgatttaataccagattcttttggtcccaatgtggctcat
ttagcaaaaggatatgatggtatctcaattttaggaaatgatacttgtaacagagaggca
ctagaaaagattaaagattgtggtataaaatacctagcaactagaactgctggagtaaat
aatatagattttgatgctgcaaaagaatttggcataaatgtagctaatgttccagcttat
tctcctaattcagtttcagagtttactataggacttgcattatccctaacaagaaaaata
ccttttgcattaaaaagagtagaacttaataattttgcactaggtggattaataggggta
gaattaagaaacttaactctaggagttataggaactggaagaataggtttaaaagtaatt
gaaggcttttcaggatttggtatgaaaaagatgataggttacgatctttttgaaaatgaa
gaagctaaaaaatatattgaatataaatccttagatgaagtattcaaagaagcagatata
ataacactacatgcacctttgacagacgataattaccatatgataggaaaagaaagtatt
gctaaaatgaaagatggtgtattcataataaatgcagcacgtggagcattaattgatagt
gaagctttaatagaagggctaaaatctggtaaaatagctggagcagccttagattcttat
gaatatgaacaaggagtcttccataataataaaatgaacgaaatcatgcaagacgataca
ttagaaagacttaagagtttcccaaatgtagttattacacctcatttaggattctataca
gatgaagccgtatcaaatatggttgaaattactcttatgaatttgcaagaatttgaatta
aaaggaacttgtaaaaatcagagggtatgtaagtaa

DBGET integrated database retrieval system