KEGG   Cajanus cajan (pigeon pea): 109814089
Entry
109814089         CDS       T04868                                 

Name
(RefSeq) (3S,6E)-nerolidol synthase 1-like
  KO
K24668  neryl diphosphate diphosphatase [EC:3.7.1.27]
Organism
ccaj  Cajanus cajan (pigeon pea)
Brite
KEGG Orthology (KO) [BR:ccaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109814089
Enzymes [BR:ccaj01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.27  neryl diphosphate diphosphatase
     109814089
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth Thioredoxin_13
Other DBs
NCBI-GeneID: 109814089
NCBI-ProteinID: XP_020234024
Position
Unknown
AA seq 518 aa
MDDIYMKQGLVLKEVKHVFQKLISENPMESLCMVDIIQRLGIEHLFEEETEAVLQNHHFI
FSSHLNDFSDNHKLYKVALAFRLLRQRGHYVHADLFDSLKSNKREFREKYGEDVKSLIAL
YEATQLSIEGEDSVDEAGYLSNQLLHAWLTTHKEHHEAIYVANTLQSPLHYGLSRFRDKN
MHLSDFKTKKEWTCLEELAEINSCIVRSMNQNEIKQVYKWWKDLGMAKEVKFARYQPLKW
YMWPMACFTDPSFSDQRIELTKPISLIYIIDDIFDVYGTIDQLTLFTDAINRWELAGTEQ
LPDFMKMCLSVLYEITNDFAEKIYKKHGLNPIDTLKRSWVKLLNAFLEEAHWLNSGHLPR
SEEYLNNGIVTTGVHVVLVHAFFLLDQTINKEIVAIVDNFPEIIHSVAKILRLSDDLEGA
QSENENGLDGSYLDCYMNEHQDISTEDAQSHVCHLISREWKRLNGQVLTSTGLPSSFTKF
CLNAARMVPLMYHYQSNPSLSRLREQIQTLLDVDAGHI
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggatgatatttatatgaaacaaggattggtattgaaggaagttaagcatgtgttccag
aaactcattagcgagaatcccatggaaagtttgtgtatggttgacattatccaaaggctt
ggcattgaacacctcttcgaagaggaaactgaagccgttcttcagaaccatcatttcata
tttagcagtcatcttaatgatttttcggataaccataaactttataaagttgcacttgcc
ttccgtttacttagacaaagaggccattatgttcatgcagatttatttgacagcttgaag
agtaacaaaagagagtttagagaaaaatatggtgaagatgtgaagagtctcattgccctg
tatgaggcaacccagttaagtattgaaggagaagatagtgttgatgaagcaggttacctc
agcaaccaacttcttcatgcatggttgacaacacataaagaacatcatgaagcaatttat
gttgctaacactcttcagagtccacttcactatggcttatcaagattcagggacaaaaat
atgcatctaagtgatttcaagaccaagaaagaatggacatgcttagaggaacttgctgaa
atcaattcctgcatagttaggtccatgaaccagaatgaaataaaacaagtttacaaatgg
tggaaagatcttggaatggcgaaggaggtgaagttcgcaaggtatcaacctcttaaatgg
tacatgtggccaatggcgtgcttcacagatccaagcttttcagaccaaaggattgagcta
actaaacctatctctctaatctacattattgatgacatcttcgatgtttatgggacaata
gaccaacttactttatttacagatgccattaatagatgggaattggctggcacagagcaa
cttccagacttcatgaaaatgtgtctaagtgttctttacgaaattacaaatgatttcgcg
gaaaagatctacaaaaaacatggattgaaccctatagataccctgaaaagatcgtgggtg
aaattgttgaatgctttcttggaagaggcacattggttgaattctggacatttgccaagg
tcagaggagtacttgaacaatggaattgtgaccacaggagtgcatgtggtgcttgtccat
gcattcttcctcttggatcagactataaacaaggaaattgttgctatcgtggacaacttc
ccagaaattatacattcagtggcaaaaattcttcgtctttctgatgatttagagggagct
cagagtgaaaatgaaaacggacttgatgggtcataccttgattgctatatgaatgaacat
caagacatttcaactgaagacgcacaaagtcatgtttgccacttgatttcacgtgaatgg
aaacgtctcaatggacaagtcctcacctcaactggattaccctcatcattcaccaaattt
tgtctcaatgcagctagaatggtacctttgatgtaccattatcaaagcaatcctagcctc
tcccgtctacgagaacaaatacaaacgttgcttgatgtcgatgctggacacatatag

DBGET integrated database retrieval system