KEGG   Cynara cardunculus var. scolymus (artichoke): 112499705
Entry
112499705         CDS       T05604                                 
Name
(RefSeq) beta-amyrin 28-oxidase-like
  KO
K22620  beta-amyrin 16beta-monooxygenase [EC:1.14.14.63]
Organism
ccav  Cynara cardunculus var. scolymus (artichoke)
Brite
KEGG Orthology (KO) [BR:ccav00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccav00199]
    112499705
Enzymes [BR:ccav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.63  beta-amyrin 16beta-monooxygenase
     112499705
Cytochrome P450 [BR:ccav00199]
 Cytochrome P450, plant type
  CYP716 family
   112499705
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 112499705
NCBI-ProteinID: XP_024958801
Position
LG 16:complement(6998507..7000382)
AA seq 480 aa
MDTLLLVSSIFVPTIITIFFLHHFFIQKSSIPGSYGWPLIGESIDYFNKLRSGTNEKFVM
QRKKLFGNVFKTSILGEKMAFFCGPEGNKFLFSNENKLVEVWWPSSVESIIKKSNNKSVT
AESAKVRQLLPPFLRAHAVKNYIADMDSELRQHLEDYWSGHDQVEVCPFVAKYTFALAVK
LLLGVRDGTELEKLAKPFVEAAGGIIAIPINIPGTRFNRGVKASNQIREVINGIIAQRRK
DLADGTASPSQDLLSHMIAEVDKRNEESDGAPTTDGDMSSDLLGLLIGGYDTINTTVVFI
MMMLVDHPDVYQAVLKEQMEIAKAKPTGELLNWDDLRKMKYSWNVACEVLRMRPPTVGAF
RVAKTDFTYAGFKIPKGWKLHYIPHFTQRNSEYFPNPEKFDPSRFEGAGPAPYTFVPFGG
GARMCPGNEYARAEILVFMYNIITRYNWQRLIPDEKVVIDPLPRPVHGLPIKLIPHNTIT
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggacaccctcctgttagtttcttccatatttgtgcccaccatcatcaccatcttcttt
ctgcaccattttttcatccaaaaatcaagcattccaggcagttatggctggccactcatc
ggtgaaagcatcgattacttcaacaagcttcgcagcggcaccaacgagaagtttgtcatg
caacgaaaaaagctatttgggaacgttttcaagacgtcgatccttggcgagaaaatggcc
ttcttctgcggccctgaaggcaacaagttcttgttctctaatgaaaacaagcttgttgaa
gtatggtggccgagttcagtcgagagtatcatcaagaaatcgaataacaagtcggtgaca
gccgaatccgccaaggtccgacagctgttgccgccgttcttgagagctcatgccgttaaa
aactatattgcggacatggattccgagttgagacagcatttggaggattactggagcggc
cacgatcaggtcgaggtttgtccgttcgtcgcaaagtacacgtttgcattggcggtaaag
ttgcttttaggtgtgcgagatgggacagagttagagaagcttgcaaagccgtttgtggag
gccgcgggtggaatcatagcgattccgattaacattcccggaacaaggttcaaccgagga
gttaaagcatcaaatcaaattagggaagtcattaacggcataatcgctcaacgaaggaaa
gaccttgctgacggaaccgcaagtccatctcaggatctgctttctcacatgatcgccgaa
gtcgataaacggaatgaggaatccgacggtgctcccaccaccgacggtgacatgtctagc
gacctgctagggttgctcattggtggctacgacaccatcaacaccacggtcgtgttcatt
atgatgatgctcgtcgatcaccccgacgtgtaccaagcagtcctaaaagagcaaatggag
atagcgaaggcgaaaccaacgggcgaactgttgaactgggacgaccttcgtaaaatgaaa
tactcctggaacgtcgcgtgtgaagtgctgaggatgcggccaccgaccgttggcgctttc
cgagtcgcgaaaaccgatttcacgtatgccggtttcaaaattccgaaagggtggaagcta
cattacatcccacatttcactcaacggaactcggagtactttccaaatccagagaaattc
gacccgtcaagattcgaaggagcgggaccagcaccttacacgttcgtgccgttcgggggc
ggtgcaaggatgtgccctggcaacgaatatgccagggcagaaatactggtgtttatgtat
aacataatcaccagatacaattggcagaggttaattccagatgaaaaggtggtcatagac
ccacttccaaggccagttcatggactcccaattaagctcattcctcataacaccataact
taa

DBGET integrated database retrieval system