Corynebacterium comes: CETAM_05175 Help Entry CETAM_05175       CDS       T07879                                  Symbol nudG Name (GenBank) CTP pyrophosphohydrolase   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ccoe  Corynebacterium comes Brite KEGG Orthology (KO) [BR:ccoe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ccoe03400]     CETAM_05175 (nudG) Enzymes [BR:ccoe01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      CETAM_05175 (nudG) DNA repair and recombination proteins [BR:ccoe03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     CETAM_05175 (nudG)  Prokaryotic type     CETAM_05175 (nudG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like NUDIX_2 Motif Other DBs NCBI-ProteinID:  QGU04306 UniProt:  A0A6B8W027 Position complement(1049681..1050076) Genome browser AA seq 131 aa AA seqDB search MKKRINVTGAVLTDGDKVLAARRGPGKALPGFWEFPGGKIEAGETPEESLARELEEELLC QAAVGAHITTTEYEYDFGTVILSTYFCKLIEGDPQLTEHEEIRWVPASELHTLNWAPADI PAVKIIAEQLG NT seq 396 nt NT seq  +upstreamnt  +downstreamnt gtgaagaagcgcatcaacgtaacaggggcagttctgactgatggagacaaagttctcgca gctcggcgcggcccaggtaaagcgcttcccggcttctgggagttcccgggagggaagatt gaagccggagaaacccccgaagagtcactcgcccgagaactggaggaggagcttctctgt caggcggccgtcggtgctcacatcaccactacggaatacgagtatgacttcggcaccgtc attctctcgacatacttctgcaagctcatcgagggagatccgcagctcacagagcacgag gagatccgatgggtaccggcctctgagctgcacacactaaattgggccccagccgacatc cctgcggtcaagatcattgccgaacagctcggctaa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (4) Pfam (4) All databases (6) Download RDF

DBGET integrated database retrieval system