KEGG   Chondromyces crocatus: CMC5_062560
Entry
CMC5_062560       CDS       T04010                                 

Definition
(GenBank) rRNA methyltransferase
  KO
K18846  16S rRNA (adenine(1408)-N(1))-methyltransferase [EC:2.1.1.180]
Organism
ccro  Chondromyces crocatus
Brite
KEGG Orthology (KO) [BR:ccro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccro03009]
    CMC5_062560
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ccro01504]
    CMC5_062560
Enzymes [BR:ccro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.180  16S rRNA (adenine1408-N1)-methyltransferase
     CMC5_062560
Ribosome biogenesis [BR:ccro03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    CMC5_062560
Antimicrobial resistance genes [BR:ccro01504]
 Gene variants
  Aminoglycoside resistance genes
   16S rRNA methyltransferases
    CMC5_062560
SSDB
Motif
Pfam: Methyltransf_4 Methyltransf_25 Methyltransf_31 Methyltransf_11
Other DBs
NCBI-ProteinID: AKT42034
UniProt: A0A0K1EMD8
Position
8522032..8522736
AA seq 234 aa
MRTQIGKNQLDIARDELLARLEGHSRVLVDVGTGDGRFVYRWASAHPETLCIGLDAVGER
MREVSHRASRKPARGGRPNALFVVASAQALPEELTGLADLISINYPWSSLFSALVLPDPV
VLAGLRRVARPGAELLLLLNQSVLDDRPYAERLGLPPLSEERIESELRPAYLAAGFTLLE
HRLLEGDAPHQTSWGQHLTLGSGRRTRLVTAQAVNPASMSASEPRASSGAAEGD
NT seq 705 nt   +upstreamnt  +downstreamnt
atgcggacgcagatcggaaagaaccagctcgacatcgcccgggacgagctgctcgcccgg
ctggaggggcacagccgcgtcctcgtcgacgtgggcacgggggatggccgcttcgtgtac
cgctgggcgagcgcccacccggagacgctgtgcatcggcctcgacgcggtcggcgagcgc
atgcgtgaggtgtcccaccgagcatcgcgcaaaccagcgcgtgggggtcgcccgaatgcg
ctgttcgtcgtggcgtccgctcaggcgctgcccgaggagctcacgggtctcgctgacctc
atctccatcaattacccctggtcctcgctcttctccgccctggtgctgccggatcccgtg
gtgctcgctggcctccggcgcgtcgcgcgtcccggggccgagctgctcctgttgctgaac
cagagtgtcctcgacgaccgcccttatgcagaacgcctcggcctccctcctctctccgag
gagaggatcgagtccgagctgcgtcctgcctacctcgcagccggtttcacgctgctggag
caccggctgctggaaggcgacgcgcctcaccagacctcgtggggtcagcacctgacgctc
ggctcggggcgtcgcacgcgcctcgtgacggcccaggcggtcaaccctgcgtccatgtcg
gcgagcgaaccccgtgcatcgtcaggggcggctgagggcgactga

DBGET integrated database retrieval system