KEGG   Candida dubliniensis: CD36_73000
Entry
CD36_73000        CDS       T01140                                 
Symbol
CPR-C2
Name
(RefSeq) NADPH-dependent alpha-keto amide reductase, putative
  KO
K19654  2-dehydropantolactone reductase [EC:1.1.1.358]
Organism
cdu  Candida dubliniensis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CD36_73000 (CPR-C2)
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.358  2-dehydropantolactone reductase
     CD36_73000 (CPR-C2)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 8049205
NCBI-ProteinID: XP_002421511
UniProt: B9WJQ5
Position
7:complement(780671..781600)
AA seq 309 aa
MTSHTHPVKLSRTFKTKAGDELSIGTGTGTKWKKDSKLDEINQELVDQILLAIKLGYRHI
DTAEVYNTQAEVGEAIKKSGIPREQLWITTKYNPGWGDIKASSASPQESIDKALKQLGTD
YIDLYLIHQPFFTEENTHGYSLIDTWKILIEAKKQGKIREIGVSNFAIKHLEALKKVSEP
EYYPVVNQIESHPFLQDQSKNITKYSQENGILVEAFSPLTPASRLDANPLTDYLEELVKK
YNKTPGQLLLRYTLQRGILPITTSAKESRIKESLDVFDFELTKEEFDKITEIGNANPHRV
FFHEAFKDL
NT seq 930 nt   +upstreamnt  +downstreamnt
atgacttcacatacccaccctgtcaaattaagcagaacattcaagacaaaagctggtgac
gagctttcaattggaactggtactggtaccaaatggaaaaaagattcaaaattggacgaa
atcaatcaagaattggttgatcaaattttgctagccataaaattggggtacagacacatt
gatactgctgaagtttacaatactcaagcagaagttggggaggcaattaaaaaatcgggt
attccaagagaacaactttggatcaccaccaaatacaacccaggatggggcgatatcaaa
gcaagtagtgccagtccacaagaatcaattgacaaggcattgaaacaattaggaaccgat
tatattgatttatacttaattcatcaaccttttttcactgaagaaaacactcatggatat
tctttaattgatacatggaaaattttgattgaagccaaaaagcaagggaaaataagagaa
attggggtttcaaattttgctattaaacacttggaggcattgaaaaaggtctctgaaccg
gaatattacccagtggtcaatcaaattgaaagtcatccatttttgcaggatcaatcgaag
aacatcaccaagtactcgcaagagaatggtattttggtggaagcattttccccattgacc
ccagcatcaagactcgatgccaacccattgactgattacttggaggaattggtgaaaaag
tataacaagacccctggccaattattattgagatacactttacaaagaggtattttacca
attaccacatcggccaaagaaagcagaatcaaagagtcattagacgtgtttgattttgaa
ttgaccaaggaggaatttgacaagataaccgaaattggtaatgccaaccctcatcgtgtc
tttttccatgaagcatttaaagatttatag

DBGET integrated database retrieval system