KEGG   Corynebacterium glutamicum SCgG2: C629_06615
Entry
C629_06615        CDS       T02691                                 

Symbol
mhpA
Name
(GenBank) 3-(3-hydroxyphenyl)propionate hydroxylase
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
cgg  Corynebacterium glutamicum SCgG2
Pathway
cgg00362  Benzoate degradation
cgg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C629_06615 (mhpA)
Enzymes [BR:cgg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     C629_06615 (mhpA)
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like ApbA FAD_oxidored Pyr_redox NAD_Gly3P_dh_N Lycopene_cycl Thi4 Cellsynth_D Pyr_redox_3
Other DBs
NCBI-ProteinID: AGN21925
Position
1405029..1406621
AA seq 530 aa
MSPNNFDADVCIVGGGPTGTLLAVLLGQKGHRVTILEKWPTFYERPRAVTFDHEIARILG
YIGIDSENDEAIDYHSDSYDWKNAAGEMLLEVDWTSMTDSGWRTRYWFYQPELEKRLRDL
ALTMDSVDIRCGFTAVGLSQDENSATIHGIVTDTPENIPADAQREDIRAKYVIGADGANS
FVRNSLGLEMNDLGYFFDWLILDLKPTQDIDYGTDHWQLCDPKRPTTIVPGGPGRRRWEF
MALPGEDLKELASEESAWKLLQPWDVTPDKAVLERSAVYRFQARWAQEWRSGRALIAGDA
AHLMPPFAGEGMCAGLRDSLALAWRLDLVLSGKSDDALLDTYGEERREHVHYYIDFSMDL
GNVICVTDENEARLRDERMIKELEAQDGVPVNTDVAHLGPGIWDKDSSHGGELAKQGIVE
YQGRKARFDDAVGRGWAVLGLNTDPREVLDEDSLVALDAIGAIVESVGDATSAVLDVEGL
YTRWLKEAGATFIITRPDFYVYSTAVDAEQLQTQIKQLSDLLHLNSVVGA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcacccaataactttgatgccgatgtctgcatcgtcggtggaggccctaccggaacg
ctccttgcagtactgctcggacaaaaaggtcaccgcgtcacaatcctggaaaagtggcca
actttctacgaacgacctcgcgcagtcacctttgatcacgaaatcgctcggatccttgga
tacattggcattgattctgaaaacgacgaagccatcgattaccactccgacagctacgac
tggaagaacgcagcgggggagatgcttttggaagttgattggacctctatgacagattcc
ggatggcgcacccgatactggttctaccagccagaacttgaaaagcgtctgcgcgatctg
gctctgactatggattctgtggatattcgctgtggcttcactgccgtcggattgtcccaa
gatgaaaactctgccaccatccacggcattgtcactgatactccagagaacatcccagca
gatgctcagcgcgaagatatccgagcgaagtatgtcatcggtgcagacggagctaacagt
ttcgtgcgtaactcccttggcttagagatgaatgatcttggatacttctttgactggctg
atcctggacctcaagccaacccaggacattgactacggaacagatcactggcaactgtgt
gatcccaagcgtccaaccaccatcgttcctggaggccccggccgtcgacgttgggaattc
atggcgctccctggtgaagacctcaaggaactcgcttctgaagaaagcgcgtggaagcta
cttcaaccatgggatgtcacacctgacaaggctgttctcgagcgctccgccgtgtatcga
ttccaagctcgatgggcccaagaatggcggtccggtagggctctcatcgcaggcgacgcc
gctcacctcatgccacctttcgcaggtgaaggcatgtgcgcgggcttgagagattcactg
gcgttggcgtggcgtcttgatttggtgctgagcggaaaatcagatgatgcattgctagac
acctacggagaagaacgtcgtgaacacgtccactactacattgatttctccatggacctg
ggcaatgtcatctgcgttacagatgaaaatgaagcacgtttgcgcgatgagcgcatgatt
aaagagcttgaagcacaagacggggtccctgttaataccgatgtcgcgcacttgggaccg
ggaatttgggataaagattcttcccatggtggcgagctagcgaagcagggcatagtggaa
taccaaggtcgaaaggcgcgtttcgacgacgcagtcggccgtggctgggcagttttaggc
ctcaacactgatccacgagaagtgcttgatgaggattcacttgtggcacttgacgccatc
ggtgcaatcgtcgaatcagtaggtgatgcaacttccgcagttttagatgttgaaggtctt
tacactcgctggctcaaggaagccggggcaacatttattattacccgccccgatttctac
gtctattccacagcagtggacgctgaacaacttcaaacacagattaagcagctatcggat
ctacttcacctcaactcagttgtcggagcatag

DBGET integrated database retrieval system