KEGG   Corynebacterium glutamicum MB001: cgp_1309
Entry
cgp_1309          CDS       T02791                                 

Name
(GenBank) putative FAD-dependent oxidoreductase
  KO
K20943  resorcinol 4-hydroxylase (NADPH) [EC:1.14.13.219]
Organism
cgm  Corynebacterium glutamicum MB001
Pathway
cgm00362  Benzoate degradation
cgm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cgp_1309
Enzymes [BR:cgm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.219  resorcinol 4-hydroxylase (NADPH)
     cgp_1309
SSDB
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 Pyr_redox_2 HI0933_like FAD_binding_2 ApbA FAD_oxidored Pyr_redox NAD_Gly3P_dh_N Thi4 Lycopene_cycl Cellsynth_D Pyr_redox_3
Other DBs
NCBI-ProteinID: AGT05148
Position
1216165..1217757
AA seq 530 aa
MSPNNFDTDVCIVGGGPTGTLLAVLLGQKGHRVTILEKWPTFYERPRAVTFDHEIARILG
YIGIDSENDEAIDYHSDSYDWKNAAGETLLEVDWTSMTDSGWRTRYWFYQPELEKRLRDL
ALTMDFVDIRCGFTAVGLSQDENSAIIHGIVTDTPENIPADAQREDIRAKYVIGADGANS
FVRNSLGLEMNDLGYFFDWLILDLKPTQDIDYGTDHWQLCDPKRPTTIVPGGPGRRRWEF
MALPGEDLKELASEESAWNLLEPWDVTPGKAILERSAVYRFQARWAQEWRSGRALIAGDA
AHLMPPFAGEGMCAGLRDSLALAWRLDLVLSGKSDDALLDTYGEERREHVHYYIDFSMDL
GNVICITDEDEARLRDERMIKELEAQDGVPVNTDVAHLGPGIWDKDSSHGGELAKQGIVE
YQGRKARFDDAVGRGWAVLGLNTDPREVLDEDSLVALDAIGAIVESVGDATSAVLDVEGL
YTRWLKEAGATFIITRPDFYVYSTAVDAEQLQTQIKQLSDLLHLNSVVGA
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtcacccaataacttcgataccgatgtctgcatcgtcggtggaggtcctaccggaacg
ctccttgcagtactgctcggccaaaaaggtcaccgcgtcaccatcctggaaaagtggcca
acattctacgaacgacctcgtgcagtcacctttgaccacgaaatcgcacggatccttgga
tacattggcattgattctgaaaacgacgaagccatcgattaccactccgacagctacgac
tggaagaacgcagcgggggagacgcttttggaagtcgattggacctccatgacagattcc
ggatggcgcacccgatactggttctaccagccagaacttgaaaagcgtctgcgcgatctg
gccctgaccatggattttgtagatattcgctgtggcttcaccgctgtcggattgtcccaa
gatgaaaactccgccatcattcacggcattgtcactgataccccagagaacattccagca
gatgctcagcgcgaagatatccgagcgaagtatgtcatcggtgcagacggagctaacagt
ttcgtgcgtaactcccttggcttagagatgaatgatcttggatacttcttcgactggctg
atcctggacctcaagccaactcaggacattgactacggaacagatcactggcaactgtgt
gatcccaagcgcccaaccaccatcgttcctggaggccccggccgccgacgttgggaattc
atggcgctgcctggtgaagatctcaaggaactcgcttctgaagaaagcgcgtggaatcta
cttgagccatgggatgtcacacctggcaaggccattctcgagcgctccgcagtgtatcga
ttccaagctcgctgggcccaggaatggcgctccggaagagctctcatcgcaggcgatgcc
gctcacctcatgccacctttcgcaggtgaaggcatgtgcgctggcctgagagactcactg
gcgttggcatggcgtcttgatttggtgctgagcggaaaatcagatgatgcattgctagac
acctacggagaagaacgccgcgaacacgtccactactacattgatttctccatggacctg
ggcaatgtcatctgcattactgatgaagatgaagcacgtttgcgcgatgagcgcatgatt
aaagagcttgaagcacaagacggggtccctgttaataccgatgtcgcacacttgggaccg
ggaatttgggataaagattcttcccatggtggcgagctagcgaagcagggcatagtggaa
taccaaggtcgaaaggcgcgtttcgacgacgcagtcggccgtggctgggcagttttaggc
ctcaacactgatccacgagaagtgcttgatgaggattcgcttgtggcacttgacgccatc
ggtgcaatcgtcgaatcagtaggtgatgcaacttccgcagttttagatgttgaaggtctt
tacactcgctggctcaaggaagccggggcaacatttattattacccgccccgatttctac
gtctattccacagcagtggacgctgaacaacttcaaacacagattaagcagctatcggat
ctacttcacctcaactcagttgtcggagcatag

DBGET integrated database retrieval system