KEGG   Candida glabrata: CAGL0A02838g
Entry
CAGL0A02838g      CDS       T01024                                 

Name
(RefSeq) uncharacterized protein
  KO
K10868  DNA repair protein XRS2
Organism
cgr  Candida glabrata
Pathway
cgr03440  Homologous recombination
cgr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cgr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CAGL0A02838g
   03450 Non-homologous end-joining
    CAGL0A02838g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgr03400]
    CAGL0A02838g
DNA repair and recombination proteins [BR:cgr03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     CAGL0A02838g
   NHEJ (non-homologous end-joining)
    MRX complex
     CAGL0A02838g
SSDB
Motif
Pfam: FHA Yop-YscD_cpl FHA_2
Other DBs
NCBI-GeneID: 2886298
NCBI-ProteinID: XP_444889
UniProt: Q6FY53
Position
A:complement(297872..300358)
AA seq 828 aa
MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN
CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS
QFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKLVN
DHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSV
EIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIESGDLYRN
AIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSL
SFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT
DDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSL
YGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDN
DPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL
IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQ
TKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRTAIGNG
NNNSANEINNSNQQLFVVDDDFEDSQDVGHLLNKADTTEPPQQLQDHEDTMNDGPGSTTP
VRNKRNRGKVSVTNGGNRVRSVVKGFTNEDDDDDDDDDEPTFKFSRHR
NT seq 2487 nt   +upstreamnt  +downstreamnt
atgtgggtgcttcggtactcttatgttgaagaaaccggggaagttaagaaagtttcatgt
tgtatccgtcaaaatgttcaatacactatcgggagatcgagcaagaataatctagtgatc
aagaatgacaagagtatatcgcgacagcatgtttcattgaagtggtccagttctaaaaat
tgtatagagctgacgaatactggtaagcttacaaagagctcggaaaagtacctaggatct
aatgaattaataacatactcggcagatgaaacccaaatagaaatgcttttgggtgtagca
cctgtgaaaattatattatccagaatagatgaattatttgacataccgaattcactcagc
cagtttagagagactttagaaacattgggcattcaaataagtgtagataatgctaatgtc
aattctacgagcctgattacagtgggtgattttggttatagagaactatttgctgcctgt
aatgatattaacatatattctagcggtctattaactgagatctgtaacaaattagtaaat
gaccatgataactttgacgctgaatggcgatcaatgcaatcatcataccataggaacttg
gacttggagggtttgctatcacaatttggtgggattagaggaaagtttttttttctgttg
tacaaaatcgattggtttattataagttatttgaagccttttctgctgaaactgtcagtt
gaaattcatgattcgatacataagaatgatgatttattaagattgataagttcaaaacaa
gctgatgaaatacccattgtgatatcgaatgagaaaataaaatacttgcctgaagacact
ttacagattcattctgatgatatatataagtttatcgagtctggtgacctctaccgaaat
gcaataagatatcagtctatggaacgtaagccaatttatgatttagaggatgaaacaaca
aatgcgattattcctcaaaaaagaagtctagcaaatacatcacagccaacagatactagt
cttgagtcgactaaaaaaaagagggttcgtcggcataaagttgaacccttaaatagcttg
agcttttttgctggcggaatatctccagtgcctggtactaacaacgaatataaccaatct
aaggttaatggacatctcgattccgaaatttctccggattcagcgtcgacaaccagagaa
cagaaaatacctggacaatcacataccatatccacaactcgaatggaacatgctttaact
gatgataattcagagccaacgatcgttcaacgctcaatagcagaaggtattagtcataga
gatcaattaattggcaatgatgaggttgttgaggatcagcatcatttaccggataggaag
aagagggacattcatgaaaatacaatgtacaataatagttacaacggtaataaatcttta
tacggtgtagagaattctcttactcaaagcaatttacttcaaagtatgggatatgaaaag
agtaataataagacggaattatccaaaaaaaatgcgggaggtataatgtcaacggagaag
aatttagatgcccaacgtccaaacttgaaatctcaaacattaaactcattggaagataat
gaccctaagcgaaccctacaaaaaagagacattgatatagttaaattagttcaaactacg
aaagaatcggaagtaaagcgtttgagttctactattgtaaaaattgaggattctgaatta
acggaagaagctatcaataaacttaatgacttagtactcgtcgagccagtagcagatttg
ataaggactaaatcggatatctctgcaaacaatactacacaacagcaatggaaaaataga
aaaaacttcaaaaaatttgtgaaaatttgtcctaaatataagagcgagcaaagcagtatt
gagtcaatgtcaaggcatatacgcggcagtggtgagattcttacgagggaattcttgcaa
actaagaatgtacctgtggattattacaactcacatcacgatcaaaatgattttgttgat
gagattaatactgcacctcaggctaataaatccaattcgtttgtgcatcaaattttacct
gaaataggagatgaaaatgagaactcgttttcctttactcgtacagctattggtaatggc
aataataattctgcaaatgagattaataacagtaaccaacaactgtttgtagttgatgat
gattttgaggactctcaagacgttggacatcttctaaataaagctgataccactgaaccg
ccacaacagcttcaagatcatgaggacacaatgaacgatggccctggtagtaccactcca
gtacgtaataaaagaaatagagggaaagtttctgttaccaatggaggtaacagagtcagg
tcggttgtaaagggcttcacaaatgaagatgatgatgatgatgatgatgatgacgaacct
actttcaagttttccaggcatcgttaa

DBGET integrated database retrieval system